BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1211 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_46218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) 29 3.8 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_11641| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-33) 28 5.0 SB_59387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 >SB_57393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 568 Score = 31.1 bits (67), Expect = 0.71 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 463 GESISAPSVFPYMKTRQKSKAKLMMMKEIISYYSFLIMYTNVLC 594 G ++ A + Y++ + K K++ + + + SY++ + ++NVLC Sbjct: 190 GFAVVANGTYIYLRRKMKRKSRHVFSRSMTSYFTQSLAWSNVLC 233 >SB_46218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 644 Score = 30.7 bits (66), Expect = 0.93 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -3 Query: 431 LILYFLAKLKCLQSSCVIGKVIRGRLYGSKYNA 333 LIL +L+ L CVI V+RG L G YNA Sbjct: 528 LILQPACRLQDLDIQCVIEDVLRGNLRGINYNA 560 >SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) Length = 4833 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 137 TSCCTCEGHHSGAKSSLPLVC 199 T C C G+++GA S+PL C Sbjct: 4307 TFLCVCVGNYTGALCSIPLAC 4327 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +3 Query: 438 NIGRLLGSRRINICAERFPIYENEAEKQSEADDDERNNIILQLS 569 N R S R IC R I NE EKQ + E N+I L+ Sbjct: 2304 NRDRSPSSVREEICYARSVIIRNEQEKQKDRRASETRNVIKHLT 2347 >SB_11641| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-33) Length = 390 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 117 ESPKNTLKVFKLFCLCFYHFFVCFNLFKFC 28 ++ K V +F LC++ FFV F F++C Sbjct: 286 KATKTLAVVVGVFILCWFPFFVIFVTFQYC 315 >SB_59387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 143 CCTCEG-HHSGAKSSLPLVCLVPRDGASSEARTKP 244 C C G HH+ K + P C V DG ++ A +P Sbjct: 663 CRQCLGLHHNSRKKTEPANCTVSGDGLTTGAANQP 697 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,746,988 Number of Sequences: 59808 Number of extensions: 409014 Number of successful extensions: 1035 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -