BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1210 (399 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 35 0.021 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 33 0.086 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 33 0.086 SB_34870| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.15 SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_13882| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.2e-13) 31 0.46 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 29 1.1 SB_5983| Best HMM Match : MIF4G (HMM E-Value=1.6) 29 1.1 SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) 29 1.1 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 1.4 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 29 1.4 SB_58993| Best HMM Match : EGF_CA (HMM E-Value=0) 29 1.8 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_10970| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_8425| Best HMM Match : EGF (HMM E-Value=0) 28 2.4 SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) 28 3.2 SB_58026| Best HMM Match : ANF_receptor (HMM E-Value=0) 28 3.2 SB_19761| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_34796| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_49805| Best HMM Match : zf-C2H2 (HMM E-Value=1.4e-12) 27 4.3 SB_48390| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_54379| Best HMM Match : AMP-binding (HMM E-Value=0.0023) 27 5.6 SB_50253| Best HMM Match : HYR (HMM E-Value=2.6e-20) 27 7.4 SB_28917| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_8748| Best HMM Match : Astacin (HMM E-Value=0) 27 7.4 SB_25879| Best HMM Match : WAP (HMM E-Value=1.8) 26 9.8 SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) 26 9.8 SB_11328| Best HMM Match : PAN (HMM E-Value=7.1e-06) 26 9.8 SB_21518| Best HMM Match : zf-C2H2 (HMM E-Value=0) 26 9.8 SB_21477| Best HMM Match : 7tm_1 (HMM E-Value=2.7e-06) 26 9.8 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 35.1 bits (77), Expect = 0.021 Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 12/85 (14%) Frame = +2 Query: 89 VCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACC---------PACVTLLGEGATCK 238 VCG+D +N C L CPKN +H G CA C CVT L + A C Sbjct: 1157 VCGSDKVSYRNKCYMIALNCPKNKYVYVKHEGYCAPCRLAECHKVYAKCVTTLYQTARCV 1216 Query: 239 IYSXEQ--AKPPPLCVRSLSNASKE 307 + ++ A+ +C + E Sbjct: 1217 CPTLQECAARKGAVCASDMKTYQSE 1241 Score = 31.9 bits (69), Expect = 0.20 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +2 Query: 83 ALVCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACCPACVTLLGE 223 A VCGTD + CI C R +HAG+C C V G+ Sbjct: 372 APVCGTDDRTYPSECIMKTSACADKKAVRVKHAGECGPCGTLVCTNGK 419 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/37 (35%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 89 VCGTDYXEK-NPCIQPPLVCPKNTEHRARHAGKCACC 196 VCGTD N C+ C K H G C C Sbjct: 229 VCGTDKSSYLNECVMKARACRKEKSVTVAHRGFCGAC 265 Score = 26.6 bits (56), Expect = 7.4 Identities = 18/71 (25%), Positives = 24/71 (33%), Gaps = 1/71 (1%) Frame = +2 Query: 83 ALVCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACCPACVTLLGEGATCKIYSXEQA 259 + VCG++ N C+ C + E +H G C C V E K Y E Sbjct: 966 SFVCGSNGKTYTNECLLKVDSCAEQKEISVKHKGACDACSNHVCEENEDCDKKTYQSECH 1025 Query: 260 KPPPLCVRSLS 292 C S Sbjct: 1026 MKEEACTEKKS 1036 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 33.1 bits (72), Expect = 0.086 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 6/45 (13%) Frame = +2 Query: 89 VCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCA-----CCPAC 205 VCG+D NPC+ VC N + R +H G C C P C Sbjct: 129 VCGSDGKTYDNPCVFKIAVCQMNGQLRLKHRGACGSRPDKCAPIC 173 Score = 32.7 bits (71), Expect = 0.11 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 89 VCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACCPACVTLLGEGA-TCKI 241 VCG+D NPC+ C N +H GKC +C +G CK+ Sbjct: 180 VCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSSQSCEQKKCKGTKVCKM 232 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 33.1 bits (72), Expect = 0.086 Identities = 21/76 (27%), Positives = 31/76 (40%), Gaps = 2/76 (2%) Frame = +2 Query: 89 VCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACCPACVTLLGEGA-TCKIYSXEQAK 262 VCG+D NPC+ C N +H GKC +C +G CK+ + Sbjct: 37 VCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSSQSCEQKKCKGTKVCKMIGNK--- 93 Query: 263 PPPLCVRSLSNASKEL 310 P C+R A ++ Sbjct: 94 --PRCMRPPQTACSKV 107 >SB_34870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 32.3 bits (70), Expect = 0.15 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 66 RQQRTVLWYVVQTTXKKIHAYSHHLFALRTLSIAPD 173 R +R VLW V + + + A+S+ LF+L + + PD Sbjct: 171 RSERRVLWDVASSKIRAVTAFSNSLFSLNSNAFCPD 206 >SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2956 Score = 30.7 bits (66), Expect = 0.46 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 140 VCPKNTEHRARHAGKCACCPACVTLLG-EGATCK 238 +CP NT KC CPA ++ G +GAT K Sbjct: 2764 LCPPNTYQDQEQQSKCHMCPAGLSTFGLQGATSK 2797 >SB_13882| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.2e-13) Length = 340 Score = 30.7 bits (66), Expect = 0.46 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 140 VCPKNTEHRARHAGKCACCPACVTLLG-EGATCK 238 +CP NT KC CPA ++ G +GAT K Sbjct: 65 LCPPNTYQDQEQQSKCHMCPAGLSTFGLQGATSK 98 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 29.5 bits (63), Expect = 1.1 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 89 VCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKC 187 VCG+D NPC+ C N +H GKC Sbjct: 51 VCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKC 84 >SB_5983| Best HMM Match : MIF4G (HMM E-Value=1.6) Length = 410 Score = 29.5 bits (63), Expect = 1.1 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +3 Query: 51 WWHALRQQRTVLWYVVQTTXKKIHAYSHH 137 W HA R +VLW+++++ KK++ + H Sbjct: 135 WSHARRNFGSVLWWLLESRIKKVNKANRH 163 >SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) Length = 87 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 89 VCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACCP 199 VCG+D N C+ C NT R G C CP Sbjct: 10 VCGSDNNTYDNECLMRQQACVANTTVAVRRKGDCEPCP 47 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 29.1 bits (62), Expect = 1.4 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 89 VCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACCP 199 VCGTD N C+ C N R G C CP Sbjct: 172 VCGTDNNTYDNECLMRQQACVANATVAVRRKGHCEPCP 209 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 29.1 bits (62), Expect = 1.4 Identities = 16/53 (30%), Positives = 19/53 (35%) Frame = +2 Query: 119 PCIQPPLVCPKNTEHRARHAGKCACCPACVTLLGEGATCKIYSXEQAKPPPLC 277 P +PP C GKC C P C +G K + PPP C Sbjct: 3183 PTTRPPCECKDGETGVLAEDGKCDCPPKC----DDGRKPKFVNNRWKCPPPEC 3231 >SB_58993| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 541 Score = 28.7 bits (61), Expect = 1.8 Identities = 23/95 (24%), Positives = 36/95 (37%), Gaps = 1/95 (1%) Frame = +2 Query: 14 KNFKMKTLIFIMLVACVASAAYGALVCGTDYXEKNPCIQPPLVCPKNTEHRARHAGKCAC 193 K+ K ++ FIM C + + +KN C++ P +C T + G C Sbjct: 237 KSCKKTSIYFIMFRYCQSLLSILCSAYTLCILDKNECVETPGIC--KTGNCTNIEGSYTC 294 Query: 194 -CPACVTLLGEGATCKIYSXEQAKPPPLCVRSLSN 295 CP + +C + E K P LC N Sbjct: 295 TCPVGYAPTRDSPSCSDIN-ECKKNPELCPYGCKN 328 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 86 LVCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACC 196 LVCGTD N C+ C N+ + + G C C Sbjct: 1519 LVCGTDNITYSNECLMKYQACRTNSALKVKRKGDCDVC 1556 Score = 28.3 bits (60), Expect = 2.4 Identities = 19/65 (29%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = +2 Query: 89 VCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACCPACVTLLGEGATCKIYSXEQAKP 265 VCG+D N C+ C NT R G C C +TCK + +P Sbjct: 1217 VCGSDNNTYDNECLMRQQACVANTTVAVRRKGDCDPCSNVTCDSPPYSTCK---AQDDQP 1273 Query: 266 PPLCV 280 +CV Sbjct: 1274 TCVCV 1278 Score = 26.6 bits (56), Expect = 7.4 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 83 ALVCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACC 196 A VCGT++ N C+ C N+ R G+C C Sbjct: 1799 AEVCGTNWKTYTNECMMRKQACMNNSMVTVRSIGRCDPC 1837 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/37 (32%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 89 VCGTDYXE-KNPCIQPPLVCPKNTEHRARHAGKCACC 196 VCG+D N C+ C N R+ G C C Sbjct: 1660 VCGSDGKTYDNECVLRMAACESNRTLAVRNEGNCGLC 1696 >SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1488 Score = 28.3 bits (60), Expect = 2.4 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 77 YGALVCGTDYXEKNPCIQPPLVCPKNTEHRARHAG 181 YG Y EK+P + PP V PK+ AR G Sbjct: 884 YGKTFRLNGYNEKSPKVSPPPVKPKSYSPEARWCG 918 >SB_10970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1256 Score = 28.3 bits (60), Expect = 2.4 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 6/58 (10%) Frame = +2 Query: 71 AAYGALVCGTDYXEKNPCIQP--PLVCPKNT-EHRARHAGKCACC---PACVTLLGEG 226 AA G+ VC + C P P+ C T + R+ CA PAC T LGEG Sbjct: 310 AADGSCVCAAGWGGST-CSLPECPITCTSGTCDLTVRYCSGCAAGFTGPACNTSLGEG 366 >SB_8425| Best HMM Match : EGF (HMM E-Value=0) Length = 1955 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 125 IQPPLVCPKNTEHRARHAGKCACCPACVTLLGEGA 229 ++P L CPK T A C+ CP + G GA Sbjct: 390 VEPCLPCPKGTYQTAIGQMSCSECPGTKSTHGPGA 424 >SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) Length = 584 Score = 27.9 bits (59), Expect = 3.2 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +2 Query: 206 VTLLGE-GATCKIYSXEQAKPPPLCVRSLSNASKELA 313 +T GE G CK E +P P CV +++ S EL+ Sbjct: 24 ITPAGERGMCCKAIKLEPERPDPPCVDKVTHCSIELS 60 >SB_58026| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 850 Score = 27.9 bits (59), Expect = 3.2 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = +2 Query: 95 GTDYXEKNPCIQPPLVCPKNTEHRARHAGKCACCPACVTLLGEGATC 235 GT E C L CP+ T R A C+ CP E +C Sbjct: 506 GTMQSESVACCWECLQCPEGTVTSIRGATNCSTCPVTQKSNRERTSC 552 >SB_19761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 27.9 bits (59), Expect = 3.2 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -2 Query: 242 KSCKLHLXQVKLH-KRDNKHTFQRVWRDAQCS 150 K+ K H+ VK H KR N TF ++ QC+ Sbjct: 27 KTVKFHVFSVKFHEKRSNSTTFGQIPPSRQCT 58 >SB_34796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 27.5 bits (58), Expect = 4.3 Identities = 8/33 (24%), Positives = 17/33 (51%) Frame = +1 Query: 1 EKRIQKFQNENVDFYNAGGMRCVSSVRCFGMWY 99 + +Q+FQ +VD + C+ + C +W+ Sbjct: 53 DPNVQRFQRSSVDTFLVSSSLCLGDLCCIKLWH 85 >SB_49805| Best HMM Match : zf-C2H2 (HMM E-Value=1.4e-12) Length = 74 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 61 RCVSSVRCFGMWYRLLXKKSMHT 129 +C V+CF Y+L KS+HT Sbjct: 20 QCCQCVKCFSTLYKLKSHKSIHT 42 >SB_48390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 116 NPCIQPPLVCPKNTEHRARHAGKCACCPACV 208 N C+ P L C N E+R R K CC + + Sbjct: 162 NSCLNPFLYCLTNKEYR-REFTKLLCCKSAI 191 >SB_54379| Best HMM Match : AMP-binding (HMM E-Value=0.0023) Length = 277 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/53 (24%), Positives = 24/53 (45%) Frame = -2 Query: 344 PXNEIDYTXLVLTLLMHLRGSLHTAEGVSPVPSNKSCKLHLXQVKLHKRDNKH 186 P + I + ++ LRG + + + PS K + L + ++ KR KH Sbjct: 223 PQDIIQFVSENISPQKRLRGGVEIVDSIPKTPSGKILRRQLREQEVEKRKMKH 275 >SB_50253| Best HMM Match : HYR (HMM E-Value=2.6e-20) Length = 525 Score = 26.6 bits (56), Expect = 7.4 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +2 Query: 89 VCGTDYXEKNPCIQPPLVCPKNTEHRARHAGKCACCPACVTLLGEGAT 232 VC T N ++P CP +T + C C +T LG+G T Sbjct: 301 VCPTGKSSSNG-LEPCRSCPFDTYQNKAQSTSCIPCGNGLTTLGKGMT 347 >SB_28917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 26.6 bits (56), Expect = 7.4 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 3/66 (4%) Frame = +2 Query: 65 ASAAYGALVCGTDYXEKNPCIQPPLVCPKNTEHRARHA---GKCACCPACVTLLGEGATC 235 AS + Y NPC Q + C + RA + GKC C P + + A C Sbjct: 84 ASEKFKPNTSSNHYSIPNPCDQ--MKCSNGGKCRANYVDNTGKCHCTPDFIGDTCDTAAC 141 Query: 236 KIYSXE 253 + + E Sbjct: 142 EAFGME 147 >SB_8748| Best HMM Match : Astacin (HMM E-Value=0) Length = 757 Score = 26.6 bits (56), Expect = 7.4 Identities = 27/94 (28%), Positives = 33/94 (35%), Gaps = 7/94 (7%) Frame = +2 Query: 56 ACVASAAYGALVCGTDYXEKNPC--IQPPLVC----PKNTEHRARHAGKCACCPACVTLL 217 AC ASAA +L G + C PP C P + ACC L Sbjct: 402 ACCASAA-PSLTAGQASTGSSCCQSAAPPPCCMTANPGTNTQVGLQTPEAACCATVTPSL 460 Query: 218 GEGATCKIYSXEQAK-PPPLCVRSLSNASKELAL 316 G S Q+ PPP C+ KE+ L Sbjct: 461 TAGQASMGSSCCQSPAPPPCCMTLKPGPEKEIEL 494 >SB_25879| Best HMM Match : WAP (HMM E-Value=1.8) Length = 260 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 26 MKTLIFIMLVACVASAAY 79 MKTLI I ++A VASA Y Sbjct: 1 MKTLIVICMLAAVASATY 18 >SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) Length = 1399 Score = 26.2 bits (55), Expect = 9.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 223 RCNLQDLFXGTGETPSAVCKEP 288 RC D + G G++ S +CK+P Sbjct: 820 RCECADGYRGDGKSCSPICKQP 841 >SB_11328| Best HMM Match : PAN (HMM E-Value=7.1e-06) Length = 435 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 185 CACCPACVTLLGEGATCKIYSXEQAKPP 268 CA CV++ GATC++ S Q P Sbjct: 53 CASANGCVSINHYGATCELNSKSQFTAP 80 >SB_21518| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 376 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/58 (22%), Positives = 24/58 (41%) Frame = +2 Query: 14 KNFKMKTLIFIMLVACVASAAYGALVCGTDYXEKNPCIQPPLVCPKNTEHRARHAGKC 187 K+FK + + ++ + CG + +K+ + LV H R+ GKC Sbjct: 272 KHFKRSSTLSTHMLIHADIRPFSCEFCGKRFHQKSDMKKHTLVHTGEKPHECRYCGKC 329 >SB_21477| Best HMM Match : 7tm_1 (HMM E-Value=2.7e-06) Length = 348 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 271 AVCKEPLKCIKRVSTXLV*SISL 339 A+ K+PLKC K +T V +SL Sbjct: 43 AIWKDPLKCFKSAATYYVVGLSL 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,176,636 Number of Sequences: 59808 Number of extensions: 238871 Number of successful extensions: 678 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 703143849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -