BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1208 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 25 2.1 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 25 2.1 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 25 2.1 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 2.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.7 AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 24 4.8 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 24 4.8 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 25.0 bits (52), Expect = 2.1 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 86 NLLIKETNSLL*IMYICHYY 27 N LI+E++S++ Y CH+Y Sbjct: 405 NRLIEESSSVMEAAYSCHWY 424 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 25.0 bits (52), Expect = 2.1 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 86 NLLIKETNSLL*IMYICHYY 27 N LI+E++S++ Y CH+Y Sbjct: 258 NRLIEESSSVMKAAYSCHWY 277 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 25.0 bits (52), Expect = 2.1 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 86 NLLIKETNSLL*IMYICHYY 27 N LI+E++S++ Y CH+Y Sbjct: 405 NRLIEESSSVMEAAYSCHWY 424 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 2.7 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +1 Query: 526 MIKPDSSK*TWENNPIHHEKWIFASXRM--KTGKNLQRIC 639 +I+ DSS E+ I HE W+ + + + L+R C Sbjct: 439 IIELDSSDNVGEDGEIQHESWVARKRKTIDRINRRLRRAC 478 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.6 bits (51), Expect = 2.7 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 282 YDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNV 380 Y +E+K L Y F ++ ID K KN+ Sbjct: 2284 YFHGLEELKLAPLTYHTFHKEIKGIDEAKSKNI 2316 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 23.8 bits (49), Expect = 4.8 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 353 NRREERQKCFETSQLPPLN 409 NRREE ++C + + + PL+ Sbjct: 33 NRREEMEQCCQVNMIIPLD 51 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 23.8 bits (49), Expect = 4.8 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 353 NRREERQKCFETSQLPPLN 409 NRREE ++C + + + PL+ Sbjct: 33 NRREEMEQCCQVNMIIPLD 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 616,593 Number of Sequences: 2352 Number of extensions: 12042 Number of successful extensions: 21 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -