BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1203 (399 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20010.1 68414.m02506 tubulin beta-5 chain (TUB5) nearly iden... 100 3e-22 At4g20890.1 68417.m03029 tubulin beta-9 chain (TUB9) nearly iden... 100 7e-22 At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly iden... 100 7e-22 At5g44340.1 68418.m05429 tubulin beta-4 chain (TUB4) nearly iden... 97 3e-21 At2g29550.1 68415.m03589 tubulin beta-7 chain (TUB7) identical t... 96 9e-21 At5g23860.1 68418.m02801 tubulin beta-8 chain (TUB8) (TUBB8) ide... 94 3e-20 At5g12250.1 68418.m01439 tubulin beta-6 chain (TUB6) nearly iden... 94 3e-20 At5g62700.1 68418.m07868 tubulin beta-2/beta-3 chain (TUB3) near... 91 2e-19 At5g62690.1 68418.m07867 tubulin beta-2/beta-3 chain (TUB2) near... 91 2e-19 At5g19780.1 68418.m02351 tubulin alpha-3/alpha-5 chain (TUA5) ne... 55 2e-08 At5g19770.1 68418.m02350 tubulin alpha-3/alpha-5 chain (TUA3) ne... 55 2e-08 At4g14960.2 68417.m02299 tubulin alpha-6 chain (TUA6) nearly ide... 55 2e-08 At4g14960.1 68417.m02298 tubulin alpha-6 chain (TUA6) nearly ide... 55 2e-08 At1g50010.1 68414.m05612 tubulin alpha-2/alpha-4 chain (TUA2) id... 55 2e-08 At1g04820.1 68414.m00478 tubulin alpha-2/alpha-4 chain (TUA4) ne... 55 2e-08 At1g64740.1 68414.m07340 tubulin alpha-1 chain (TUA1) nearly ide... 54 4e-08 At5g05620.1 68418.m00612 tubulin gamma-2 chain / gamma-2 tubulin... 48 2e-06 At3g61650.1 68416.m06909 tubulin gamma-1 chain / gamma-1 tubulin... 48 2e-06 At4g37190.1 68417.m05265 expressed protein 30 0.49 At3g10900.1 68416.m01312 (1-4)-beta-mannan endohydrolase, putati... 29 0.86 At2g26850.1 68415.m03221 F-box family protein contains Pfam PF00... 29 0.86 At2g32810.1 68415.m04016 beta-galactosidase, putative / lactase,... 27 6.1 >At1g20010.1 68414.m02506 tubulin beta-5 chain (TUB5) nearly identical to SP|P29513 Tubulin beta-5 chain {Arabidopsis thaliana} Length = 449 Score = 100 bits (240), Expect = 3e-22 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 397 RINVYYNEASGG+YVPRAV++DLEPGTMDS+RSGPFGQIFRPDNFVF Sbjct: 47 RINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPFGQIFRPDNFVF 93 Score = 83.4 bits (197), Expect = 5e-17 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 1/45 (2%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD-SDLQL 254 MREI+HIQ GQCGNQIG+KFWEVI DEHGID+TG YSGD +DLQL Sbjct: 1 MREILHIQGGQCGNQIGSKFWEVICDEHGIDSTGRYSGDTADLQL 45 >At4g20890.1 68417.m03029 tubulin beta-9 chain (TUB9) nearly identical to SP|P29517 Tubulin beta-9 chain {Arabidopsis thaliana} Length = 444 Score = 99.5 bits (237), Expect = 7e-22 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 397 RINVY+NEASGGKYVPRAV++DLEPGTMDS+RSGPFGQIFRPDNFVF Sbjct: 46 RINVYFNEASGGKYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVF 92 Score = 79.8 bits (188), Expect = 6e-16 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254 MREI+HIQ GQCGNQIGAKFWEVI EHGID TG GD+DLQL Sbjct: 1 MREILHIQGGQCGNQIGAKFWEVICGEHGIDQTGQSCGDTDLQL 44 >At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly identical to SP|P12411 Tubulin beta-1 chain {Arabidopsis thaliana} Length = 447 Score = 99.5 bits (237), Expect = 7e-22 Identities = 42/47 (89%), Positives = 47/47 (100%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 397 RINVYYNEASGG+YVPRAV++DLEPGTMDS+RSGP+GQIFRPDNFVF Sbjct: 47 RINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVF 93 Score = 81.8 bits (193), Expect = 2e-16 Identities = 35/45 (77%), Positives = 40/45 (88%), Gaps = 1/45 (2%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS-DLQL 254 MREI+H+Q GQCGNQIG+KFWEVI DEHG+D TG Y+GDS DLQL Sbjct: 1 MREILHVQGGQCGNQIGSKFWEVICDEHGVDPTGRYNGDSADLQL 45 >At5g44340.1 68418.m05429 tubulin beta-4 chain (TUB4) nearly identical to SP|P24636 Tubulin beta-4 chain {Arabidopsis thaliana} Length = 444 Score = 97.5 bits (232), Expect = 3e-21 Identities = 42/47 (89%), Positives = 47/47 (100%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 397 RI+VY+NEASGGKYVPRAV++DLEPGTMDS+RSGPFGQIFRPDNFVF Sbjct: 46 RIDVYFNEASGGKYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVF 92 Score = 83.8 bits (198), Expect = 4e-17 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254 MREI+HIQ GQCGNQIGAKFWEVI DEHGID TG Y GDS LQL Sbjct: 1 MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGQYVGDSPLQL 44 >At2g29550.1 68415.m03589 tubulin beta-7 chain (TUB7) identical to GB:M84704 SP|P29515 Tubulin beta-7 chain {Arabidopsis thaliana} Length = 449 Score = 95.9 bits (228), Expect = 9e-21 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 397 R+NVYYNEAS G+YVPRAV++DLEPGTMDSVRSGP+GQIFRPDNFVF Sbjct: 46 RVNVYYNEASCGRYVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVF 92 Score = 80.6 bits (190), Expect = 4e-16 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254 MREI+HIQ GQCGNQIG+KFWEV++ EHGID TG Y GDS+LQL Sbjct: 1 MREILHIQGGQCGNQIGSKFWEVVNLEHGIDQTGRYVGDSELQL 44 >At5g23860.1 68418.m02801 tubulin beta-8 chain (TUB8) (TUBB8) identical to SP|P29516 Tubulin beta-8 chain {Arabidopsis thaliana}; supporting cDNA gi|15451225|gb|AY054693.1| Length = 449 Score = 94.3 bits (224), Expect = 3e-20 Identities = 40/47 (85%), Positives = 46/47 (97%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 397 R+NVYYNEAS G++VPRAV++DLEPGTMDSVRSGP+GQIFRPDNFVF Sbjct: 46 RVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVF 92 Score = 82.2 bits (194), Expect = 1e-16 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254 MREI+HIQ GQCGNQIGAKFWEV+ EHGID+TG Y G++DLQL Sbjct: 1 MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQL 44 >At5g12250.1 68418.m01439 tubulin beta-6 chain (TUB6) nearly identical to SP|P29514 Tubulin beta-6 chain {Arabidopsis thaliana} Length = 449 Score = 94.3 bits (224), Expect = 3e-20 Identities = 39/47 (82%), Positives = 46/47 (97%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 397 R+NVYYNEAS G+YVPRA+++DLEPGTMDSVR+GP+GQIFRPDNFVF Sbjct: 46 RVNVYYNEASCGRYVPRAILMDLEPGTMDSVRTGPYGQIFRPDNFVF 92 Score = 83.4 bits (197), Expect = 5e-17 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254 MREI+HIQ GQCGNQIG+KFWEV+ DEHGID TG Y G+SDLQL Sbjct: 1 MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQL 44 >At5g62700.1 68418.m07868 tubulin beta-2/beta-3 chain (TUB3) nearly identical to SP|P29512 Tubulin beta-2/beta-3 chain {Arabidopsis thaliana} Length = 450 Score = 91.5 bits (217), Expect = 2e-19 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 397 RINVYYNEAS G++VPRAV++DLEPGTMDS+RSGP+GQ FRPDNFVF Sbjct: 46 RINVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVF 92 Score = 84.6 bits (200), Expect = 2e-17 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254 MREI+HIQ GQCGNQIGAKFWEV+ EHGID TG Y+GDSDLQL Sbjct: 1 MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQL 44 >At5g62690.1 68418.m07867 tubulin beta-2/beta-3 chain (TUB2) nearly identical to SP|P29512 Tubulin beta-2/beta-3 chain {Arabidopsis thaliana} Length = 450 Score = 91.5 bits (217), Expect = 2e-19 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVF 397 RINVYYNEAS G++VPRAV++DLEPGTMDS+RSGP+GQ FRPDNFVF Sbjct: 46 RINVYYNEASCGRFVPRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVF 92 Score = 84.6 bits (200), Expect = 2e-17 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254 MREI+HIQ GQCGNQIGAKFWEV+ EHGID TG Y+GDSDLQL Sbjct: 1 MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQL 44 >At5g19780.1 68418.m02351 tubulin alpha-3/alpha-5 chain (TUA5) nearly identical to SP|P20363 Tubulin alpha-3/alpha-5 chain {Arabidopsis thaliana} Length = 450 Score = 55.2 bits (127), Expect = 2e-08 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +2 Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFV 394 N +++E GK+VPRAV VDLEP +D VR+G + Q+F P+ + Sbjct: 50 NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI 93 Score = 40.3 bits (90), Expect = 5e-04 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242 MREI+ I GQ G Q+G WE+ EHGI G D+ Sbjct: 1 MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDT 40 >At5g19770.1 68418.m02350 tubulin alpha-3/alpha-5 chain (TUA3) nearly identical to SP|P20363 Tubulin alpha-3/alpha-5 chain {Arabidopsis thaliana} Length = 450 Score = 55.2 bits (127), Expect = 2e-08 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +2 Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFV 394 N +++E GK+VPRAV VDLEP +D VR+G + Q+F P+ + Sbjct: 50 NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI 93 Score = 40.3 bits (90), Expect = 5e-04 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242 MREI+ I GQ G Q+G WE+ EHGI G D+ Sbjct: 1 MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDT 40 >At4g14960.2 68417.m02299 tubulin alpha-6 chain (TUA6) nearly identical to SP|P29511 Tubulin alpha-6 chain {Arabidopsis thaliana} Length = 450 Score = 55.2 bits (127), Expect = 2e-08 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +2 Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFV 394 N +++E GK+VPRAV VDLEP +D VR+G + Q+F P+ + Sbjct: 50 NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI 93 Score = 39.9 bits (89), Expect = 6e-04 Identities = 18/39 (46%), Positives = 21/39 (53%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239 MRE + I GQ G Q+G WE+ EHGI G GD Sbjct: 1 MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39 >At4g14960.1 68417.m02298 tubulin alpha-6 chain (TUA6) nearly identical to SP|P29511 Tubulin alpha-6 chain {Arabidopsis thaliana} Length = 427 Score = 55.2 bits (127), Expect = 2e-08 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +2 Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFV 394 N +++E GK+VPRAV VDLEP +D VR+G + Q+F P+ + Sbjct: 50 NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI 93 Score = 39.9 bits (89), Expect = 6e-04 Identities = 18/39 (46%), Positives = 21/39 (53%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239 MRE + I GQ G Q+G WE+ EHGI G GD Sbjct: 1 MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGD 39 >At1g50010.1 68414.m05612 tubulin alpha-2/alpha-4 chain (TUA2) identical to tubulin alpha-2/alpha-4 chain SP|P29510 GB:P29510 from [Arabidopsis thaliana] Length = 450 Score = 55.2 bits (127), Expect = 2e-08 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +2 Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFV 394 N +++E GK+VPRAV VDLEP +D VR+G + Q+F P+ + Sbjct: 50 NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI 93 Score = 37.5 bits (83), Expect = 0.003 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239 MRE + I GQ G Q+G WE+ EHGI G D Sbjct: 1 MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD 39 >At1g04820.1 68414.m00478 tubulin alpha-2/alpha-4 chain (TUA4) nearly identical to SP:P29510 Tubulin alpha-2/alpha-4 chain from [Arabidopsis thaliana] Length = 450 Score = 55.2 bits (127), Expect = 2e-08 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +2 Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFV 394 N +++E GK+VPRAV VDLEP +D VR+G + Q+F P+ + Sbjct: 50 NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI 93 Score = 37.5 bits (83), Expect = 0.003 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGD 239 MRE + I GQ G Q+G WE+ EHGI G D Sbjct: 1 MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD 39 >At1g64740.1 68414.m07340 tubulin alpha-1 chain (TUA1) nearly identical to SP|P11139 Tubulin alpha-1 chain {Arabidopsis thaliana} Length = 450 Score = 54.0 bits (124), Expect = 4e-08 Identities = 20/44 (45%), Positives = 32/44 (72%) Frame = +2 Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFV 394 N +++E S G++VPRAV +DLEP +D VR+G + Q+F P+ + Sbjct: 50 NTFFSETSSGQHVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLI 93 Score = 41.9 bits (94), Expect = 2e-04 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242 MREI+ I GQ G Q+G WE+ EHGI G DS Sbjct: 1 MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDS 40 >At5g05620.1 68418.m00612 tubulin gamma-2 chain / gamma-2 tubulin (TUBG2) identical to SP|P38558 Tubulin gamma-2 chain (Gamma-2 tubulin) {Arabidopsis thaliana} Length = 474 Score = 48.0 bits (109), Expect = 2e-06 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = +3 Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224 REI+ +Q GQCGNQIG +FW+ + EHGI G Sbjct: 3 REIITLQVGQCGNQIGMEFWKQLCLEHGISKDG 35 Score = 39.9 bits (89), Expect = 6e-04 Identities = 13/44 (29%), Positives = 30/44 (68%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDN 388 R +V++ +A Y+PRA+++DLEP ++ +++G + ++ +N Sbjct: 47 RKDVFFYQADDQHYIPRALLIDLEPRVINGIQNGEYRNLYNHEN 90 >At3g61650.1 68416.m06909 tubulin gamma-1 chain / gamma-1 tubulin (TUBG1) identical to SP|P38557 Tubulin gamma-1 chain (Gamma-1 tubulin) {Arabidopsis thaliana} Length = 474 Score = 48.0 bits (109), Expect = 2e-06 Identities = 19/33 (57%), Positives = 24/33 (72%) Frame = +3 Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224 REI+ +Q GQCGNQIG +FW+ + EHGI G Sbjct: 3 REIITLQVGQCGNQIGMEFWKQLCLEHGISKDG 35 Score = 39.9 bits (89), Expect = 6e-04 Identities = 13/44 (29%), Positives = 30/44 (68%) Frame = +2 Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDN 388 R +V++ +A Y+PRA+++DLEP ++ +++G + ++ +N Sbjct: 47 RKDVFFYQADDQHYIPRALLIDLEPRVINGIQNGDYRNLYNHEN 90 >At4g37190.1 68417.m05265 expressed protein Length = 562 Score = 30.3 bits (65), Expect = 0.49 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 123 MREIVHIQAGQCGNQIGAKFW 185 MREIV IQ G+ N +G+ FW Sbjct: 1 MREIVTIQVGEFANFVGSHFW 21 >At3g10900.1 68416.m01312 (1-4)-beta-mannan endohydrolase, putative similar to (1-4)-beta-mannan endohydrolase [Coffea arabica] GI:10178872, (1-4)-beta-mannan endohydrolase GB:AAB87859 [Lycopersicon esculentum]; contains Pfam profile PF00150: Cellulase (glycosyl hydrolase family 5) Length = 408 Score = 29.5 bits (63), Expect = 0.86 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +3 Query: 129 EIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLNASMSTI 275 +I++ A + G+ GA FWEVIS + ++G S + L+ ST+ Sbjct: 346 DIIYASAQKGGSAAGALFWEVIS-----EGMSNFAGPSSIILSDKSSTV 389 >At2g26850.1 68415.m03221 F-box family protein contains Pfam PF00646: F-box domain; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 371 Score = 29.5 bits (63), Expect = 0.86 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 185 PELCSDLIPALTRLDVDDFPHDCTKNLEPP 96 P+L S ++ ++ LD+ D P DC L PP Sbjct: 50 PDLASPVLGKMSILDLPDLPLDCILELLPP 79 >At2g32810.1 68415.m04016 beta-galactosidase, putative / lactase, putative similar to beta-galactosidase GI:7939617 from [Lycopersicon esculentum] Length = 887 Score = 26.6 bits (56), Expect = 6.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 144 QAGQCGNQIGAKFWEVISDEHGIDATGAYSG 236 QA G IG ++W +IS + G D T Y G Sbjct: 678 QAWVNGQHIG-RYWNIISQKDGCDRTCDYRG 707 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,617,804 Number of Sequences: 28952 Number of extensions: 195704 Number of successful extensions: 492 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -