BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1201 (439 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 5.1 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 5.1 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 5.1 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 5.1 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 5.1 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 5.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 5.1 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 5.1 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.6 bits (46), Expect = 1.7 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 317 DVERALSFA-PRRGTAVFQELWRLFAVVVRMLGN 415 D + AL P A ++ LW L + ++R +GN Sbjct: 249 DFQMALKHVGPSSQVADYRSLWMLLSKLIRDVGN 282 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 5.1 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -1 Query: 430 GQSADISQHPNHDSEQPPELLKDRGATTRSEAQRALY 320 GQS +++ NHD P + G T+ A Y Sbjct: 871 GQSFTLTKGNNHDQGVPSAGPGEAGEYTKQPGMLAYY 907 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 5.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 410 PTSEPRQRTASRALERPRCHDAERSST 330 P +P TAS+ L P + SST Sbjct: 153 PPGKPATSTASQNLSSPASSTSSTSST 179 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 5.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 410 PTSEPRQRTASRALERPRCHDAERSST 330 P +P TAS+ L P + SST Sbjct: 153 PPGKPATSTASQNLSSPASSTSSTSST 179 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 5.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 410 PTSEPRQRTASRALERPRCHDAERSST 330 P +P TAS+ L P + SST Sbjct: 153 PPGKPATSTASQNLSSPASSTSSTSST 179 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 5.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 410 PTSEPRQRTASRALERPRCHDAERSST 330 P +P TAS+ L P + SST Sbjct: 153 PPGKPATSTASQNLSSPASSTSSTSST 179 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 5.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 410 PTSEPRQRTASRALERPRCHDAERSST 330 P +P TAS+ L P + SST Sbjct: 109 PPGKPATSTASQNLSSPASSTSSTSST 135 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 5.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 410 PTSEPRQRTASRALERPRCHDAERSST 330 P +P TAS+ L P + SST Sbjct: 153 PPGKPATSTASQNLSSPASSTSSTSST 179 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 5.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 410 PTSEPRQRTASRALERPRCHDAERSST 330 P +P TAS+ L P + SST Sbjct: 153 PPGKPATSTASQNLSSPASSTSSTSST 179 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,808 Number of Sequences: 336 Number of extensions: 1618 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9775509 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -