BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1198 (647 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006618-3|AAK68251.3| 960|Caenorhabditis elegans Patched relat... 29 3.8 AC024812-7|AAF59548.2| 419|Caenorhabditis elegans Hypothetical ... 28 6.6 >AC006618-3|AAK68251.3| 960|Caenorhabditis elegans Patched related family protein 4 protein. Length = 960 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 258 DYDSRI-YRFGSGTLKTAFDLMTTSLSSLGWKNPISAAIAS 139 DY I YR+ KTA + + +L+S+GW P++ A+ S Sbjct: 853 DYSVHICYRYHRSEYKTAQEKVADTLASVGW--PVTQAVCS 891 >AC024812-7|AAF59548.2| 419|Caenorhabditis elegans Hypothetical protein Y54E10BR.8 protein. Length = 419 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 479 FQYFEVTTEEQTASSLSSVIWSR 547 F+ E T EEQT L S IWSR Sbjct: 8 FRCCECTVEEQTMEHLESHIWSR 30 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,985,277 Number of Sequences: 27780 Number of extensions: 266617 Number of successful extensions: 599 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -