BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1197 (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40574| Best HMM Match : Dynein_light (HMM E-Value=0) 120 8e-28 SB_6167| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_22293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_13708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 >SB_40574| Best HMM Match : Dynein_light (HMM E-Value=0) Length = 89 Score = 120 bits (290), Expect = 8e-28 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +2 Query: 74 MCDRKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGR 253 M +RKAVIKNADM+E+MQ DA++CATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGR Sbjct: 1 MSERKAVIKNADMAEDMQTDAIECATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGR 60 Score = 64.1 bits (149), Expect = 9e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 247 GSYFGSYVTHETRHFIYFYLGQVAILLFKSG 339 G FGSYVTHET+HFIYFYLGQVAILLFKSG Sbjct: 59 GRNFGSYVTHETKHFIYFYLGQVAILLFKSG 89 >SB_6167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/54 (38%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = +2 Query: 92 VIKNADMSEEMQQDAVDCATQALEKFNIEKDIAA-FIKKEFDKKYNPTWHCIVG 250 +I+ +DM++EM+ +A++ A EKF+ + AA IK+ DKK+ +WH +VG Sbjct: 26 LIRYSDMNDEMRTEAMELCVTACEKFSNNNETAAKMIKESMDKKFGASWHAVVG 79 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 31.5 bits (68), Expect = 0.61 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 544 SETVHPLSHSLETV-HTSTSLASSCHTLAASYLWECTTARASHE 416 ++T H +SH+L T H + + CH L +Y +E A+ SHE Sbjct: 867 AQTSHEMSHALHTYRHRAQTSHEMCHAL-YTYAYELHRAQTSHE 909 >SB_22293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1239 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 232 LALHRGSYFGSYVTHETRHFIYFYLGQVAILLFKSG*T 345 L HR GSY H I+ Y G++ +L+++ T Sbjct: 837 LTAHRSPVLGSYYGDPLPHIIHLYWGRITEILYRTSFT 874 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +1 Query: 232 LALHRGSYFGSYVTHETRHFIYFYLGQVAILLFKSG*T 345 L HR GSY + H ++ Y G++ ++ +++ T Sbjct: 931 LTAHRSPVLGSYYGNPLPHTVHLYWGRITMIPYRTSFT 968 >SB_13708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -1 Query: 444 NVPQPEPRMRICKGYPSDNTASAANKKIEVMLNGLT 337 N P EP + + G P DNT ++ KI V NG + Sbjct: 7 NRPVHEP-LAVLSGVPKDNTIPSSAPKISVSKNGFS 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,920,340 Number of Sequences: 59808 Number of extensions: 402826 Number of successful extensions: 1044 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1041 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -