BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1195 (349 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X98507-1|CAA67131.1| 1028|Homo sapiens myosin I beta protein. 32 0.43 BC068013-1|AAH68013.1| 1028|Homo sapiens myosin IC protein. 32 0.43 BC044891-1|AAH44891.2| 1028|Homo sapiens MYO1C protein protein. 32 0.43 AB210015-1|BAE06097.1| 1097|Homo sapiens MYO1C variant protein p... 32 0.43 AK127627-1|BAC87063.1| 662|Homo sapiens protein ( Homo sapiens ... 29 4.0 >X98507-1|CAA67131.1| 1028|Homo sapiens myosin I beta protein. Length = 1028 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 97 VLPALSAEDVSYQACVDKYSRKGYQP 174 VL AL +E + Y V KY RKGY+P Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900 >BC068013-1|AAH68013.1| 1028|Homo sapiens myosin IC protein. Length = 1028 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 97 VLPALSAEDVSYQACVDKYSRKGYQP 174 VL AL +E + Y V KY RKGY+P Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900 >BC044891-1|AAH44891.2| 1028|Homo sapiens MYO1C protein protein. Length = 1028 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 97 VLPALSAEDVSYQACVDKYSRKGYQP 174 VL AL +E + Y V KY RKGY+P Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900 >AB210015-1|BAE06097.1| 1097|Homo sapiens MYO1C variant protein protein. Length = 1097 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 97 VLPALSAEDVSYQACVDKYSRKGYQP 174 VL AL +E + Y V KY RKGY+P Sbjct: 944 VLQALGSEPIQYAVPVVKYDRKGYKP 969 >AK127627-1|BAC87063.1| 662|Homo sapiens protein ( Homo sapiens cDNA FLJ45725 fis, clone HCHON2009766. ). Length = 662 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 109 LSAEDVSYQACVDKYSRKGYQPWQEWSDHYTCHRYRCEIRDGKYFIAAVDVENQK 273 LS ED +A K K Q W+ W DH + +R G Y++ D E ++ Sbjct: 581 LSEEDDEREADKQKAKGKKKQWWRPWVDHASM------VRSGDYYLFETDSEEEE 629 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,805,303 Number of Sequences: 237096 Number of extensions: 1010345 Number of successful extensions: 2245 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2245 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 2026198370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -