BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1195 (349 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 1.4 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 3.2 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 4.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 5.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 5.5 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 20 9.6 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 1.4 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 175 WQEWSDHYTCHRYRCEIRDGKYFIAAVDVENQKYRITHW 291 W E Y H++ D Y AA+D E K +T W Sbjct: 175 WNEERKQYYLHQFATGQPDLNYRSAALDQE-MKNVLTFW 212 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.4 bits (43), Expect = 3.2 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = +1 Query: 139 CVDKYSRKGYQPWQEWSDHYTCHRYRCEIRD 231 CV+ Y R W + + H+ + C + D Sbjct: 110 CVNPYDRDSLSCWLQMTKHHNFIKV-CSVND 139 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.0 bits (42), Expect = 4.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 84 HNQRSQLLPVLYSQDASH 31 +NQ++ L+PV YS SH Sbjct: 187 NNQQNILIPVNYSALLSH 204 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.6 bits (41), Expect = 5.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 275 YFWFSTSTAAMKYFPSLI 222 Y WF+TS + F LI Sbjct: 549 YIWFTTSGTISEKFRKLI 566 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.6 bits (41), Expect = 5.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 275 YFWFSTSTAAMKYFPSLI 222 Y WF+TS + F LI Sbjct: 602 YIWFTTSGTISEKFRKLI 619 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 19.8 bits (39), Expect = 9.6 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +3 Query: 252 CGCRKPKIPDNALECHXYIE 311 CG R K P + EC E Sbjct: 142 CGLRLEKFPFDVQECPLIFE 161 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,823 Number of Sequences: 438 Number of extensions: 1856 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 7936320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -