BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1191 (698 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4MJZ0 Cluster: Glycine--tRNA ligase; n=1; Petrotoga mo... 33 6.7 UniRef50_Q7YWJ4 Cluster: Putative esophageal gland cell secretor... 33 8.9 >UniRef50_A4MJZ0 Cluster: Glycine--tRNA ligase; n=1; Petrotoga mobilis SJ95|Rep: Glycine--tRNA ligase - Petrotoga mobilis SJ95 Length = 689 Score = 33.1 bits (72), Expect = 6.7 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 3/63 (4%) Frame = +3 Query: 381 SKSFL*NILRHRFTNIPKNYAKNY*WEQGHH---RVAVCVSFLPTQRFLEFDIFNMRSAT 551 +K L NI+ TN+ N+AK+ W +G++ R V L + LEF++FN +S+ Sbjct: 126 TKIILQNIIPELITNM--NFAKSMRWGKGNYTFVRPVHWVLGLYNREILEFEMFNEKSSN 183 Query: 552 QNY 560 ++Y Sbjct: 184 KSY 186 >UniRef50_Q7YWJ4 Cluster: Putative esophageal gland cell secretory protein 17; n=1; Meloidogyne incognita|Rep: Putative esophageal gland cell secretory protein 17 - Meloidogyne incognita (Southern root-knot nematode) Length = 437 Score = 32.7 bits (71), Expect = 8.9 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +3 Query: 33 FNEKQKKNT*SETKHYLFTVKHQKIITQNI*KQSNQNKL 149 F E+QKK T E +HYL++V + K I K N K+ Sbjct: 146 FTEEQKKMTSEEFEHYLYSVPYDKNKKNKIGKNENGEKV 184 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,123,221 Number of Sequences: 1657284 Number of extensions: 11931001 Number of successful extensions: 27661 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27656 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -