BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1190 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synth... 25 0.48 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 7.8 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 7.8 >AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synthase 16 kDa proteolipidsubunit protein. Length = 156 Score = 25.4 bits (53), Expect = 0.48 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 470 NERHPADTGRWRAQGQASPGIFNSRGAADGSDISSVGLS 586 +E HP + G AS IF++ GAA G+ S G++ Sbjct: 3 DEDHPIYAPFFGVMGAASAIIFSALGAAYGTAKSGTGIA 41 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 414 FPDKPWKGQQNEPN 455 F D+P G+ N+PN Sbjct: 234 FLDEPLSGETNDPN 247 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 414 FPDKPWKGQQNEPN 455 F D+P G+ N+PN Sbjct: 234 FLDEPLSGETNDPN 247 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,539 Number of Sequences: 438 Number of extensions: 4510 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -