BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1189 (469 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022716-1|AAY55132.1| 536|Drosophila melanogaster RE69201p pro... 27 9.6 AE014134-951|AAF52276.2| 606|Drosophila melanogaster CG31646-PA... 27 9.6 >BT022716-1|AAY55132.1| 536|Drosophila melanogaster RE69201p protein. Length = 536 Score = 27.5 bits (58), Expect = 9.6 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -2 Query: 324 NARSTSILVRGASLGNG-DSVTSNAIAVLIW----VWRLTDHLTTASNGSDSSSRGTEY 163 N++ + L RG S G D S V + +W DH +++S+ S +SSRG ++ Sbjct: 391 NSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRDH 449 >AE014134-951|AAF52276.2| 606|Drosophila melanogaster CG31646-PA protein. Length = 606 Score = 27.5 bits (58), Expect = 9.6 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -2 Query: 324 NARSTSILVRGASLGNG-DSVTSNAIAVLIW----VWRLTDHLTTASNGSDSSSRGTEY 163 N++ + L RG S G D S V + +W DH +++S+ S +SSRG ++ Sbjct: 470 NSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRDH 528 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,216,065 Number of Sequences: 53049 Number of extensions: 360825 Number of successful extensions: 1349 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1347 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1580609772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -