BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1188 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 25 1.7 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 25 2.3 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 374 HRRPSVHLDPIREFQKCIRSCPLKLLDCTDL 282 H P P EFQ+C +CP D DL Sbjct: 28 HPYPYDLCGPNEEFQECGTACPKTCADLNDL 58 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 374 HRRPSVHLDPIREFQKCIRSCPLKLLDCTDLLVDIFPEMLY-CFC 243 H P P EFQ C +CP D +L + + CFC Sbjct: 28 HPYPYDVCGPNEEFQTCGTACPNTCADLNELQKPCTKQCIQGCFC 72 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 704,044 Number of Sequences: 2352 Number of extensions: 14822 Number of successful extensions: 35 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -