BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1187 (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 0.67 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 0.67 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 0.67 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 3.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 3.6 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 24.2 bits (50), Expect = 0.67 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 Query: 367 PKRPGTDGVHGSRLKVHH 314 P+ PGT ++ ++LK HH Sbjct: 139 PREPGTPRINFTKLKRHH 156 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.2 bits (50), Expect = 0.67 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -1 Query: 389 SCPVGRFAQTARNGRSPWFQAQGPPSQLAGRTCPLK 282 +CP + A+ G P GP ++L G L+ Sbjct: 263 ACPTPEYRWYAQTGSEPMLVLSGPRTRLLGSVLALE 298 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.2 bits (50), Expect = 0.67 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -1 Query: 389 SCPVGRFAQTARNGRSPWFQAQGPPSQLAGRTCPLK 282 +CP + A+ G P GP ++L G L+ Sbjct: 263 ACPTPEYRWYAQTGSEPMLVLSGPRTRLLGSVLALE 298 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 3.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 46 FFLHDQILESVYL 84 FFLH Q+L YL Sbjct: 259 FFLHKQVLNRYYL 271 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 3.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 46 FFLHDQILESVYL 84 FFLH Q+L YL Sbjct: 259 FFLHKQVLNRYYL 271 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,629 Number of Sequences: 438 Number of extensions: 3083 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -