BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1185 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54110| Best HMM Match : Hexapep (HMM E-Value=9.8e-14) 30 1.6 SB_18984| Best HMM Match : DNA_topoisoIV (HMM E-Value=0) 29 2.9 SB_9053| Best HMM Match : TIG (HMM E-Value=0) 29 2.9 SB_47814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_56403| Best HMM Match : fn3 (HMM E-Value=1.5e-29) 29 3.8 SB_47241| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_38688| Best HMM Match : TP901-1_ORF40 (HMM E-Value=1.7) 28 5.0 SB_28079| Best HMM Match : MCPsignal (HMM E-Value=0.00064) 28 5.0 SB_26882| Best HMM Match : MCPsignal (HMM E-Value=0.00063) 28 5.0 SB_38050| Best HMM Match : Hexapep (HMM E-Value=0.04) 28 6.6 SB_34483| Best HMM Match : Hexapep (HMM E-Value=0.0027) 28 6.6 SB_36300| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) 28 6.6 SB_53106| Best HMM Match : PLAT (HMM E-Value=0) 27 8.7 SB_12293| Best HMM Match : OATP (HMM E-Value=0) 27 8.7 >SB_54110| Best HMM Match : Hexapep (HMM E-Value=9.8e-14) Length = 729 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -2 Query: 264 MLDCIIALAGHVLQDLLNVEDGDAFVSVIDVV 169 +LD + + G L D ++VEDGDA + +DVV Sbjct: 125 LLDDVDVVDGATLLDDVDVEDGDAMLDDVDVV 156 >SB_18984| Best HMM Match : DNA_topoisoIV (HMM E-Value=0) Length = 1182 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/48 (41%), Positives = 24/48 (50%) Frame = +3 Query: 270 VAQTAGIIAHLSAGIPGDACAAANVINSYTDGVRSGNFXGFRQSLGPF 413 VAQ AG IA LSA G+A +IN + V S N Q +G F Sbjct: 364 VAQLAGSIAELSAYHHGEASLMGTIINLAENFVGSNNI-NLLQPVGQF 410 >SB_9053| Best HMM Match : TIG (HMM E-Value=0) Length = 2990 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +1 Query: 55 VATSAYAAPSVTINQYSDNEIPRDIDDGKASSVISRAWDYVDDTDKSIAILNVQEI 222 V++ AY A VTI +YSD I++ + S W+ DD ++ LN+ ++ Sbjct: 2786 VSSKAYGA-RVTIGKYSDRAGKAAIENVEFSLCGQEGWNDWDDPRYALTYLNLDDV 2840 >SB_47814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1492 Score = 28.7 bits (61), Expect = 3.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +2 Query: 449 STRHQPWSTPILCRTSP 499 + +H PW+TP++ RT P Sbjct: 536 TVKHGPWNTPVVARTKP 552 >SB_56403| Best HMM Match : fn3 (HMM E-Value=1.5e-29) Length = 236 Score = 28.7 bits (61), Expect = 3.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +2 Query: 449 STRHQPWSTPILCRTSP 499 + +H PW+TP++ RT P Sbjct: 218 TVKHGPWNTPVVARTKP 234 >SB_47241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.7 bits (61), Expect = 3.8 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Frame = +1 Query: 106 DNEIPRDIDDGK----ASSVISRAWDYVDDTDKSIAILNVQEILKDMASQGDYAVKHQ 267 D + +D DD A+ V++ DY DD D ++NV+ +L AS Y KH+ Sbjct: 49 DYDEVKDNDDNNVGDLANGVVADENDYDDDCDNYDYLINVEGLLYMNASLWKYMEKHK 106 >SB_38688| Best HMM Match : TP901-1_ORF40 (HMM E-Value=1.7) Length = 576 Score = 28.3 bits (60), Expect = 5.0 Identities = 26/83 (31%), Positives = 31/83 (37%), Gaps = 6/83 (7%) Frame = +1 Query: 106 DNEIPRDIDDGKASSVISRAWDYVDDTDKSIAILN------VQEILKDMASQGDYAVKHQ 267 D EI R+ D A SV + VD +D S I+ Q L S G Y Q Sbjct: 80 DTEINREYDFSGAKSVKKTSITLVDYSDGSNKIVENTKTDLPQSGLLGKISSGSYVGGRQ 139 Query: 268 RWPKPPELSPIYLPVSPVMPVQP 336 P P SP + PV P Sbjct: 140 ALPPPSRWSPHITHKNETQPVGP 162 >SB_28079| Best HMM Match : MCPsignal (HMM E-Value=0.00064) Length = 257 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = -3 Query: 491 SDRVSELTRVDDELIDKIQVLSHVSEEGTERLSEAXEVSGPDXVCVRVNDVSGCT-GITG 315 +D E+T+ DE+ID ++ +++ T+R E + + D + R ++ T IT Sbjct: 80 TDSTGEITKTKDEIIDSTDEITDRTDKITDRTGEITDRT--DKITDRTGKITDSTVEITD 137 Query: 314 DTG 306 TG Sbjct: 138 STG 140 >SB_26882| Best HMM Match : MCPsignal (HMM E-Value=0.00063) Length = 217 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = -3 Query: 491 SDRVSELTRVDDELIDKIQVLSHVSEEGTERLSEAXEVSGPDXVCVRVNDVSGCT-GITG 315 +D E+T+ DE+ID ++ +++ T+R E + + D + R ++ T IT Sbjct: 61 TDSTGEITKTKDEIIDSTDEITDRTDKITDRTGEITDRT--DKITDRTGKITDSTVEITD 118 Query: 314 DTG 306 TG Sbjct: 119 STG 121 >SB_38050| Best HMM Match : Hexapep (HMM E-Value=0.04) Length = 324 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = -2 Query: 276 GPPLMLDCIIALAGHVLQDLLNVEDGDAFVSVIDVV 169 G PL LD + + G L D +NV DGD + +DVV Sbjct: 147 GDPL-LDDVDVVDGVTLLDDVNVVDGDPLLDDVDVV 181 >SB_34483| Best HMM Match : Hexapep (HMM E-Value=0.0027) Length = 323 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = -2 Query: 276 GPPLMLDCIIALAGHVLQDLLNVEDGDAFVSVIDVV 169 G PL LD + + G L D +NV DGD + +DVV Sbjct: 146 GDPL-LDDVDVVDGVTLLDDVNVVDGDPLLDDVDVV 180 >SB_36300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 82 SVTINQYSDNEIPRDIDDGKASSVISRAWDYVDDTDKSIAILNVQE-ILKDMASQGD 249 +VT +SD + + D KA+++ S YV++ + N+QE IL D ++G+ Sbjct: 15 AVTSVDFSDPQGGKGACDRKAATIKSHIRQYVNEGHDVVTAANLQEAILADGGARGE 71 >SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) Length = 509 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -1 Query: 184 CHR-RSPMHVRLRN*LFHHQCRVEFHYH 104 CHR R H+RL L +H+ R+ H+H Sbjct: 440 CHRPRLSNHLRLSRHLHYHRRRLSIHHH 467 >SB_53106| Best HMM Match : PLAT (HMM E-Value=0) Length = 1790 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 220 ILKDMASQGDYAVKHQRWPKPPELSPIYLPVSPVMPVQP 336 ++ +A + Y K+ RW P+ +PI +P+ MP P Sbjct: 1139 VVYHIARKERYVFKNNRWIGGPDPTPIDIPLESQMPDIP 1177 >SB_12293| Best HMM Match : OATP (HMM E-Value=0) Length = 1446 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 485 RVSELTRVDDELIDKIQVLSHVSEE 411 + E+TR+ D++ KIQVL SEE Sbjct: 1194 KTGEVTRMLDDIAQKIQVLKRKSEE 1218 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,249,849 Number of Sequences: 59808 Number of extensions: 368813 Number of successful extensions: 1512 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1510 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -