BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1184 (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.5 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 9.6 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 594 HVL*CTPFDFFAXXILFLRA*YKFSLN 514 H+L C F FF +LFL F+L+ Sbjct: 179 HLLFCCAFIFFNMHLLFLLCLDYFTLH 205 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 594 HVL*CTPFDFFAXXILFLRA*YKF 523 H+L C F F +LFL Y F Sbjct: 265 HLLFCCAFIIFTMHLLFLLCIYYF 288 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.0 bits (42), Expect = 9.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 220 INKIIGTKYHIALIFSKYKPIALIWRVVHI 131 INK K+ I+ KPI + R+V I Sbjct: 47 INKSSTDKFGNGAIYEVLKPIYALMRIVGI 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,341 Number of Sequences: 336 Number of extensions: 2884 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -