BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1184 (697 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78059-1|CAH04725.2| 348|Caenorhabditis elegans Hypothetical pr... 29 3.2 U22833-3|AAA64323.2| 387|Caenorhabditis elegans Hypothetical pr... 28 7.3 >Z78059-1|CAH04725.2| 348|Caenorhabditis elegans Hypothetical protein C34B4.5 protein. Length = 348 Score = 29.1 bits (62), Expect = 3.2 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = +2 Query: 32 YVYKXFILNTILLFFRTLSCKYL*LFRYXSLKMDMNNPPNQSYWFVLREDQSNVILSTNN 211 +V F+L+T+ T S + +F + LK P + +WF+L+ S ILST N Sbjct: 43 FVILLFVLSTVTATLLTASFLIMAVFLWNHLK------PMKFFWFLLQLTISAFILSTLN 96 Query: 212 FVNQNP 229 V P Sbjct: 97 LVFNVP 102 >U22833-3|AAA64323.2| 387|Caenorhabditis elegans Hypothetical protein W02B3.4 protein. Length = 387 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +2 Query: 458 MTLHRM*VLLQMNVVXNQKFKENLY*ALKKRIXXAKKSNGVHYNTCEEVFKGVEIT 625 + L M + Q V NQ +EN Y + K+S +HY TCE + T Sbjct: 13 LLLSSMLIFYQTTVFRNQLNEENDYTG-GPIVPFMKRSLALHYQTCESFLNSLNTT 67 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,496,328 Number of Sequences: 27780 Number of extensions: 251436 Number of successful extensions: 516 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 516 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -