BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1181 (628 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68303-4|CAA92637.1| 210|Caenorhabditis elegans Hypothetical pr... 59 2e-09 >Z68303-4|CAA92637.1| 210|Caenorhabditis elegans Hypothetical protein ZK809.3 protein. Length = 210 Score = 59.3 bits (137), Expect = 2e-09 Identities = 30/65 (46%), Positives = 40/65 (61%) Frame = +2 Query: 41 MTIVGRVASERERCLGMTDAERAWRKQWLKDQVLAAHEPVHVEEYWRERTNPIRRFYRKP 220 M++ +A ER R G++ AER WRK+W+ DQ L A EPV V+ R+ NPIR YR P Sbjct: 41 MSLELHMADERVRAAGLSPAEREWRKKWVHDQHLHADEPVVVDAVHRQ-LNPIRTAYRLP 99 Query: 221 LDVLF 235 D + Sbjct: 100 WDKFY 104 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +1 Query: 247 PNAGEQRAAHYRYISGKLGLIAVAMLSTHYYFKYLGNDWTKKGG 378 P G R + KL + V + + +YY+KY DWT G Sbjct: 110 PTFGVYYGTAIRVTAPKLLMAFVVVQTAYYYWKYEVKDWTHLRG 153 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,878,634 Number of Sequences: 27780 Number of extensions: 297396 Number of successful extensions: 767 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1374536540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -