BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1174 (449 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75711-7|CAB00031.2| 380|Caenorhabditis elegans Hypothetical pr... 29 1.6 AF286377-1|AAG10298.1| 380|Caenorhabditis elegans POU family II... 29 1.6 AL110484-6|CAE46683.1| 1345|Caenorhabditis elegans Hypothetical ... 28 3.6 AL110484-5|CAB60334.3| 1343|Caenorhabditis elegans Hypothetical ... 28 3.6 Z70752-5|CAA94758.1| 901|Caenorhabditis elegans Hypothetical pr... 27 6.3 Z70750-16|CAA94750.1| 901|Caenorhabditis elegans Hypothetical p... 27 6.3 >Z75711-7|CAB00031.2| 380|Caenorhabditis elegans Hypothetical protein K02B12.1 protein. Length = 380 Score = 29.1 bits (62), Expect = 1.6 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 299 IXTSTMDYRLKNNVERPDMIQLLMDAYKGTLKXESNES 412 + TST ++K VERP++IQ LM + + ++S Sbjct: 130 VVTSTPSCQIKQEVERPEIIQRLMPPWPPAYQFSCDDS 167 >AF286377-1|AAG10298.1| 380|Caenorhabditis elegans POU family III homeodomain proteinCEH-6 protein. Length = 380 Score = 29.1 bits (62), Expect = 1.6 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 299 IXTSTMDYRLKNNVERPDMIQLLMDAYKGTLKXESNES 412 + TST ++K VERP++IQ LM + + ++S Sbjct: 130 VVTSTPSCQIKQEVERPEIIQRLMPPWPPAYQFSCDDS 167 >AL110484-6|CAE46683.1| 1345|Caenorhabditis elegans Hypothetical protein Y38E10A.6b protein. Length = 1345 Score = 27.9 bits (59), Expect = 3.6 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = +2 Query: 233 SNVSQENRIKVFPXKVTRFFREIXTSTMDYRLKNNVERPDMIQLLMDAYK 382 +N +I++ ++ +FR+ S+++ N E P ++LL +AY+ Sbjct: 1044 TNYQLSKQIRIGMPQIREWFRKKRESSVEEHRTNGTELPKQMKLLHEAYQ 1093 >AL110484-5|CAB60334.3| 1343|Caenorhabditis elegans Hypothetical protein Y38E10A.6a protein. Length = 1343 Score = 27.9 bits (59), Expect = 3.6 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = +2 Query: 233 SNVSQENRIKVFPXKVTRFFREIXTSTMDYRLKNNVERPDMIQLLMDAYK 382 +N +I++ ++ +FR+ S+++ N E P ++LL +AY+ Sbjct: 1042 TNYQLSKQIRIGMPQIREWFRKKRESSVEEHRTNGTELPKQMKLLHEAYQ 1091 >Z70752-5|CAA94758.1| 901|Caenorhabditis elegans Hypothetical protein F25B3.1 protein. Length = 901 Score = 27.1 bits (57), Expect = 6.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 106 PXPVSDSRLIRWSTRITNSTSXVK 177 P P+ L+ W R+TN S VK Sbjct: 329 PQPIDGETLLSWCQRVTNGYSHVK 352 >Z70750-16|CAA94750.1| 901|Caenorhabditis elegans Hypothetical protein F25B3.1 protein. Length = 901 Score = 27.1 bits (57), Expect = 6.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 106 PXPVSDSRLIRWSTRITNSTSXVK 177 P P+ L+ W R+TN S VK Sbjct: 329 PQPIDGETLLSWCQRVTNGYSHVK 352 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,911,100 Number of Sequences: 27780 Number of extensions: 135133 Number of successful extensions: 381 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -