BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1173 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 2.3 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 23 3.0 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 4.0 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 6.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 6.9 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 9.2 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 9.2 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 23.0 bits (47), Expect = 2.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 553 GWSWSFXMPY 582 GWSW MPY Sbjct: 179 GWSWDEVMPY 188 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 131 KDYFPKGISVQTTFDLHDNTEWQVQDKHTIVPQ 229 K F G+ + FD +DN + V + VPQ Sbjct: 163 KSLFENGVEIGINFDKYDNIQVNVSGDN--VPQ 193 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.2 bits (45), Expect = 4.0 Identities = 7/38 (18%), Positives = 16/38 (42%) Frame = +2 Query: 179 HDNTEWQVQDKHTIVPQYYRLSSGHWNPAWSISTILTG 292 + N W + + YR++ W+ W + ++G Sbjct: 108 YPNWSWAKNQNCSGITSVYRIAIDEWDRLWVLDNGISG 145 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -2 Query: 453 NCCSISSTYSGNNSQNILFF 394 N C+ S+ Y NN+ L++ Sbjct: 309 NSCNYSNNYYNNNNYKKLYY 328 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +2 Query: 422 PEYVEEIEQQLKQRQEAMLLNQDSGAN 502 P+ ++ +QQ +Q+Q + N D N Sbjct: 841 PQQQQQQQQQQQQQQRGPMTNDDFNPN 867 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 242 SSGHWNPAWSISTILTGLLSFMLEK 316 SSGHW S+ +L + M+ + Sbjct: 237 SSGHWQDQMSLPQMLADKIGKMVNQ 261 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +2 Query: 320 PTLGSIETSEYQKRCLAAESLEINIKNKM 406 P + + ET Q ++ +E+N+KN++ Sbjct: 51 PVMNNTETLTVQLGLKLSQLIEMNLKNQV 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,881 Number of Sequences: 438 Number of extensions: 4432 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -