BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1173 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative ... 118 2e-27 At5g50430.1 68418.m06245 ubiquitin-conjugating enzyme, putative ... 118 3e-27 At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative ... 101 3e-22 At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10)... 59 3e-09 At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10)... 59 3e-09 At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E... 59 3e-09 At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E... 59 3e-09 At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E... 59 3e-09 At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11)... 59 3e-09 At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa ... 58 3e-09 At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa ... 58 3e-09 At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative ... 58 4e-09 At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative ... 58 4e-09 At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E... 58 6e-09 At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) id... 58 6e-09 At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family pro... 57 8e-09 At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative ... 54 5e-08 At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative ... 54 5e-08 At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative ... 54 7e-08 At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative ... 54 7e-08 At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative ... 54 7e-08 At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative ... 54 7e-08 At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E... 53 2e-07 At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E... 53 2e-07 At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E... 53 2e-07 At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E... 52 3e-07 At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E... 47 8e-06 At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative ... 47 1e-05 At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13)... 46 1e-05 At3g24515.1 68416.m03077 ubiquitin-conjugating enzyme, putative ... 45 3e-05 At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative ... 45 4e-05 At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14)... 44 6e-05 At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20)... 40 0.001 At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative ... 40 0.001 At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative ... 40 0.002 At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative ... 39 0.003 At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19)... 38 0.007 At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative ... 37 0.009 At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E... 37 0.009 At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E... 37 0.012 At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family pro... 34 0.063 At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E... 34 0.083 At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family pro... 34 0.083 At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family pro... 32 0.33 At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related si... 32 0.33 At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family pro... 32 0.33 At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family pro... 31 0.44 At5g03470.1 68418.m00303 serine/threonine protein phosphatase 2A... 31 0.58 At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family pro... 31 0.77 At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family pro... 31 0.77 At2g39740.1 68415.m04880 expressed protein 30 1.0 At5g59460.1 68418.m07452 scarecrow-like transcription factor 11 ... 29 2.4 At4g22400.1 68417.m03237 expressed protein 29 3.1 At3g60630.1 68416.m06784 scarecrow transcription factor family p... 29 3.1 At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16)... 29 3.1 At4g19190.1 68417.m02832 zinc knuckle (CCHC-type) family protein... 28 4.1 At3g44610.1 68416.m04796 protein kinase family protein similar t... 28 5.4 At5g54880.1 68418.m06836 DTW domain-containing protein contains ... 27 7.2 At3g52560.2 68416.m05785 ubiquitin-conjugating enzyme family pro... 27 7.2 At2g42700.1 68415.m05287 expressed protein 27 7.2 At2g36060.2 68415.m04428 ubiquitin-conjugating enzyme family pro... 27 7.2 At1g56030.1 68414.m06433 MIF4G domain-containing protein / U-box... 27 7.2 At1g23670.2 68414.m02987 expressed protein contains Pfam profile... 27 7.2 At1g23670.1 68414.m02986 expressed protein contains Pfam profile... 27 7.2 At1g10340.2 68414.m01165 ankyrin repeat family protein contains ... 27 7.2 At1g10340.1 68414.m01164 ankyrin repeat family protein contains ... 27 7.2 At1g04910.1 68414.m00488 expressed protein contains Pfam PF03138... 27 7.2 At5g63810.1 68418.m08008 beta-galactosidase, putative / lactase,... 27 9.5 At1g75800.1 68414.m08805 pathogenesis-related thaumatin family p... 27 9.5 At1g22260.1 68414.m02782 expressed protein 27 9.5 >At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme 6 from [Homo sapiens] GI:14029267, [Mus musculus] GI:14029263; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 237 Score = 118 bits (285), Expect = 2e-27 Identities = 47/84 (55%), Positives = 65/84 (77%) Frame = +3 Query: 3 YLRLKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYM 182 Y L +PV +V A P P++ILEWHYV++G E +P+ GG+Y+GKI FP E+P+KPP I M Sbjct: 14 YRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYKPPGITM 73 Query: 183 ITPNGRFKTNTRLCLSITDFHPDT 254 TPNGRF T ++CLS++DFHP++ Sbjct: 74 TTPNGRFMTQKKICLSMSDFHPES 97 Score = 85.8 bits (203), Expect = 2e-17 Identities = 49/120 (40%), Positives = 69/120 (57%), Gaps = 1/120 (0%) Frame = +2 Query: 137 YFPKGISVQTTFDLHDNTEWQVQDKHTIVPQYYRLSSGHWNPAWSISTILTGLLSFMLEK 316 Y P GI++ T N + Q K + + S WNP WS+S+ILTGLLSFM++ Sbjct: 66 YKPPGITMTTP-----NGRFMTQKKICLSMSDFHPES--WNPMWSVSSILTGLLSFMMDT 118 Query: 317 TPTLGSIETSEYQKRCLAAESLEINIKNKMFCELFPEYVEEI-EQQLKQRQEAMLLNQDS 493 +PT GS+ T+ +K+ LA SL N K F +LFPEYVE+ +QQL ++ L +S Sbjct: 119 SPTTGSVNTTVIEKQRLAKSSLAFNCKTPAFRKLFPEYVEKYNQQQLAEQATTQLTTPES 178 >At5g50430.1 68418.m06245 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme 6 from [Homo sapiens] GI:14029267, [Mus musculus] GI:14029263; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 243 Score = 118 bits (284), Expect = 3e-27 Identities = 47/84 (55%), Positives = 65/84 (77%) Frame = +3 Query: 3 YLRLKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYM 182 Y L +PV +V A P P++ILEWHYV++G E +P+ GG+Y+GKI FP E+P+KPP I M Sbjct: 14 YRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYKPPGITM 73 Query: 183 ITPNGRFKTNTRLCLSITDFHPDT 254 TPNGRF T ++CLS++DFHP++ Sbjct: 74 TTPNGRFVTQKKICLSMSDFHPES 97 Score = 88.2 bits (209), Expect = 4e-18 Identities = 41/84 (48%), Positives = 55/84 (65%) Frame = +2 Query: 254 WNPAWSISTILTGLLSFMLEKTPTLGSIETSEYQKRCLAAESLEINIKNKMFCELFPEYV 433 WNP WS+S+ILTGLLSFM++ +PT GS+ TS +K+ LA SL N K+ F +LFPEYV Sbjct: 98 WNPMWSVSSILTGLLSFMMDNSPTTGSVNTSVAEKQRLAKSSLAFNCKSVTFRKLFPEYV 157 Query: 434 EEIEQQLKQRQEAMLLNQDSGANE 505 E+ QQ +EA + N+ Sbjct: 158 EKYSQQQVAEEEAATQQTTTSENQ 181 >At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative similar to Non-Canonical UBiquitin Conjugating Enzyme 1 (NCUBE1) from [Gallus gallus] GI:7362937, [Mus musculus] GI:7363050, [Homo sapiens] GI:7362973; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 309 Score = 101 bits (243), Expect = 3e-22 Identities = 36/68 (52%), Positives = 54/68 (79%) Frame = +3 Query: 48 PVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITPNGRFKTNTRLCL 227 P+ NI EW + ++GP + +EGG YHG+I P ++PFKPPS ++TPNGRF+TNT++CL Sbjct: 35 PLEENIFEWQFAIRGPGDTEFEGGIYHGRIQLPADYPFKPPSFMLLTPNGRFETNTKICL 94 Query: 228 SITDFHPD 251 SI+++HP+ Sbjct: 95 SISNYHPE 102 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +2 Query: 251 HWNPAWSISTILTGLLSFM-LEKTPTLGSIETSEYQKRCLAAESLE 385 HW P+WS+ T L L++FM LGS++ + ++R LA +S E Sbjct: 103 HWQPSWSVRTALVALIAFMPTSPNGALGSVDYPKDERRTLAIKSRE 148 >At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 58.8 bits (136), Expect = 3e-09 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A PV ++ W + GP +SPY GG + I FP ++PFKPP + T Sbjct: 13 LQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VFHPNINSNGSICLDI 88 >At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 58.8 bits (136), Expect = 3e-09 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A PV ++ W + GP +SPY GG + I FP ++PFKPP + T Sbjct: 13 LQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VFHPNINSNGSICLDI 88 >At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 145 Score = 58.8 bits (136), Expect = 3e-09 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A PV ++ W + GP +SPY GG + I FP ++PFKPP + T Sbjct: 13 LQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VFHPNINSNGSICLDI 88 >At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 58.8 bits (136), Expect = 3e-09 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A PV ++ W + GP +SPY GG + I FP ++PFKPP + T Sbjct: 13 LQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VFHPNINSNGSICLDI 88 >At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 58.8 bits (136), Expect = 3e-09 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A PV ++ W + GP +SPY GG + I FP ++PFKPP + T Sbjct: 13 LQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VFHPNINSNGSICLDI 88 >At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11) E2; identical to gi:12643427, SP:P35134 Length = 148 Score = 58.8 bits (136), Expect = 3e-09 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A PV ++ W + GP +SPY GG + I FP ++PFKPP + T Sbjct: 13 LQKDPPSNCSAGPVAEDMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VYHPNINSNGSICLDI 88 >At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 178 Score = 58.4 bits (135), Expect = 3e-09 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A PV ++ W + GP SPY GG + I FP ++PFKPP + T Sbjct: 43 LQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTK 102 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 103 VFHPNINSNGSICLDI 118 >At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 148 Score = 58.4 bits (135), Expect = 3e-09 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A PV ++ W + GP SPY GG + I FP ++PFKPP + T Sbjct: 13 LQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VFHPNINSNGSICLDI 88 >At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative strong similarity to SP|P35133 Ubiquitin-conjugating enzyme E2-17 kDa 10 (EC 6.3.2.19) (Ubiquitin- protein ligase 10) (Ubiquitin carrier protein 10) {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A P ++ W + GP +SPY GG + I FP ++PFKPP + T Sbjct: 13 LQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VFHPNINSNGNICLDI 88 >At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative identical or nearly so to Ubiquitin-conjugating enzymes SP|P35132, SP|P35131, SP|P35133 from {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 58.0 bits (134), Expect = 4e-09 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A PV ++ W + GP SPY GG + I FP ++PFKPP + T Sbjct: 13 LQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VFHPNVNSNGSICLDI 88 >At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 149 Score = 57.6 bits (133), Expect = 6e-09 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 2/75 (2%) Frame = +3 Query: 15 KNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP- 191 K+ P + A PV ++ W + GP +SPY GG + I FP ++PFKPP + T Sbjct: 15 KDPPTSCIFAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKV 74 Query: 192 -NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 75 FHPNINSNGSICLDI 89 >At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) identical to ubiquitin-conjugating enzyme COP10 [Arabidopsis thaliana] GI:20065779; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 182 Score = 57.6 bits (133), Expect = 6e-09 Identities = 25/59 (42%), Positives = 33/59 (55%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMIT 188 L DP P +A P N+ W + GP +PYEGG + IIFP ++PFKPP + T Sbjct: 48 LNIDPPPDCSAGPKGDNLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKT 106 >At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family protein similar to Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 154 Score = 57.2 bits (132), Expect = 8e-09 Identities = 22/45 (48%), Positives = 31/45 (68%) Frame = +3 Query: 57 SNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 +NI EW V++GP+ +PYEGG ++ I FP ++PFKPP TP Sbjct: 34 NNIYEWTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTP 78 >At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 54.4 bits (125), Expect = 5e-08 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A P ++ +W + GP SP+ GG + I FP ++PFKPP + T Sbjct: 13 LQRDPPVSCSAGPTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VYHPNINSNGSICLDI 88 >At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 54.4 bits (125), Expect = 5e-08 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 2/76 (2%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ DP +A P ++ +W + GP SP+ GG + I FP ++PFKPP + T Sbjct: 13 LQRDPPVSCSAGPTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTK 72 Query: 192 --NGRFKTNTRLCLSI 233 + +N +CL I Sbjct: 73 VYHPNINSNGSICLDI 88 >At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative similar to SP|O60015 Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) {Pichia angusta}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 157 Score = 54.0 bits (124), Expect = 7e-08 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 4/63 (6%) Frame = +3 Query: 57 SNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMIT----PNGRFKTNTRLC 224 +NI +W ++KGP ++PYEGG + P +P +PP + +T PN FKT +C Sbjct: 32 TNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTG-EIC 90 Query: 225 LSI 233 L I Sbjct: 91 LDI 93 >At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 54.0 bits (124), Expect = 7e-08 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Frame = +3 Query: 9 RLKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMIT 188 RL ++P P ++A P N+ ++ ++ GP +SPYEGG + ++ P E+P P + +T Sbjct: 16 RLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLT 75 Query: 189 P--NGRFKTNTRLCLSI 233 + R+CL I Sbjct: 76 KIYHPNIDKLGRICLDI 92 >At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 112 Score = 54.0 bits (124), Expect = 7e-08 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Frame = +3 Query: 9 RLKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMIT 188 RL ++P P ++A P N+ ++ ++ GP +SPYEGG + ++ P E+P P + +T Sbjct: 16 RLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLT 75 Query: 189 P--NGRFKTNTRLCLSI 233 + R+CL I Sbjct: 76 KIYHPNIDKLGRICLDI 92 >At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 54.0 bits (124), Expect = 7e-08 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 2/77 (2%) Frame = +3 Query: 9 RLKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMIT 188 RL ++P P ++A P N+ ++ ++ GP +SPYEGG + ++ P E+P P + +T Sbjct: 16 RLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLT 75 Query: 189 P--NGRFKTNTRLCLSI 233 + R+CL I Sbjct: 76 KIYHPNIDKLGRICLDI 92 >At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E2; identical to gi:2689242, SP:P42745 Length = 152 Score = 52.8 bits (121), Expect = 2e-07 Identities = 19/62 (30%), Positives = 39/62 (62%) Frame = +3 Query: 3 YLRLKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYM 182 + RL+ DP ++ P +NI+ W+ V+ GP+ +P++GG + + F ++P KPP++ Sbjct: 13 FKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRF 72 Query: 183 IT 188 ++ Sbjct: 73 VS 74 >At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 52.8 bits (121), Expect = 2e-07 Identities = 19/62 (30%), Positives = 39/62 (62%) Frame = +3 Query: 3 YLRLKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYM 182 + RL+ DP ++ P +NI+ W+ V+ GP+ +P++GG + + F ++P KPP++ Sbjct: 13 FKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRF 72 Query: 183 IT 188 ++ Sbjct: 73 VS 74 >At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 52.8 bits (121), Expect = 2e-07 Identities = 19/62 (30%), Positives = 39/62 (62%) Frame = +3 Query: 3 YLRLKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYM 182 + RL+ DP ++ P +NI+ W+ V+ GP+ +P++GG + + F ++P KPP++ Sbjct: 13 FKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRF 72 Query: 183 IT 188 ++ Sbjct: 73 VS 74 >At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E2; identical to gi:431261, SP:P42746 Length = 150 Score = 52.0 bits (119), Expect = 3e-07 Identities = 19/62 (30%), Positives = 38/62 (61%) Frame = +3 Query: 3 YLRLKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYM 182 + RL+ DP ++ P +NI+ W+ ++ GPE +P++GG + + F ++P KPP + Sbjct: 13 FKRLQKDPPVGISGAPQDNNIMHWNALIFGPEDTPWDGGTFKLTLHFTEDYPNKPPIVRF 72 Query: 183 IT 188 ++ Sbjct: 73 VS 74 >At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E2; identical to gi:992703, SP:P42747 Length = 198 Score = 47.2 bits (107), Expect = 8e-06 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +3 Query: 60 NILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP--NGRFKTNTRLCLSI 233 NI EW + GP + YEGG+++ + FP+ +P PP++ + + ++ R+C+SI Sbjct: 65 NIFEWSVTIIGPPDTLYEGGFFNAIMTFPQNYPNSPPTVRFTSDMWHPNVYSDGRVCISI 124 Query: 234 TDFHP 248 HP Sbjct: 125 --LHP 127 >At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative strong similar to ubiquitin-conjugating enzymes E2-17 from [Arabidopsis thaliana] SP|P35134, SP|P35132, SP|P35133; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 149 Score = 46.8 bits (106), Expect = 1e-05 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 3/77 (3%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPS-NILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMIT 188 ++ P +A PV +I W + GP SPY GG + I F ++PFKPP + T Sbjct: 13 MQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPPKVNFKT 72 Query: 189 P--NGRFKTNTRLCLSI 233 + + +CL I Sbjct: 73 KVYHPNIDSKGSICLDI 89 >At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13) E2; identical to gi:992706 Length = 166 Score = 46.4 bits (105), Expect = 1e-05 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 60 NILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP--NGRFKTNTRLCLSI 233 NI EW + GP + YEGG+++ + FP+ +P PP++ + + + R+C+SI Sbjct: 33 NIFEWSVTIIGPPDTLYEGGFFYAIMSFPQNYPNSPPTVRFTSDIWHPNVYPDGRVCISI 92 Query: 234 TDFHP 248 HP Sbjct: 93 --LHP 95 >At3g24515.1 68416.m03077 ubiquitin-conjugating enzyme, putative similar to Ubiquitin-conjugating enzyme E2 (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Xenopus laevis} SP|P51669, {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 409 Score = 45.2 bits (102), Expect = 3e-05 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 2/82 (2%) Frame = +3 Query: 84 VKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP--NGRFKTNTRLCLSITDFHPDTG 257 ++GPE + Y G ++ KI P +PF+PP + TP + + R+CL I + P Sbjct: 51 IEGPEDTVYANGIFNLKIQIPERYPFQPPIVSFATPIYHPNIDNSGRICLDILNLPPK-- 108 Query: 258 TLLGLFLRSLQVC*VLCWRRLL 323 G + SL + VL RLL Sbjct: 109 ---GAWQPSLNISTVLTSMRLL 127 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 248 GHWNPAWSISTILTGLLSFMLEKTPTLG 331 G W P+ +IST+LT + + E P G Sbjct: 109 GAWQPSLNISTVLTSMRLLLSEPNPDDG 136 >At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme from [Oryza sativa] GI:1373001, {Arabidopsis thaliana} SP|P35134, SP|P35131; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 177 Score = 44.8 bits (101), Expect = 4e-05 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +3 Query: 48 PVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSI 176 P P NI W V GP PYE G + + P ++P++PP I Sbjct: 54 PSPENIFRWEATVNGPVGCPYEKGVFTVSVHIPPKYPYEPPKI 96 >At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14) E2; UbcAT3; identical to gi:2129757, S46656 Length = 167 Score = 44.4 bits (100), Expect = 6e-05 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 60 NILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP--NGRFKTNTRLCLSI 233 N+ +W + GP + YEGG+++ + FP +P PP++ + + ++ ++C+SI Sbjct: 34 NVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPVSPPTVTFTSEMWHPNVYSDGKVCISI 93 Query: 234 TDFHP 248 HP Sbjct: 94 --LHP 96 >At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20) nearly identical to ubiquitin-conjugating enzyme UBC20 [Arabidopsis thaliana] GI:22530867; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 180 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 30 PYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSI 176 P ++A P NI W + G + + +EG Y + F ++PFKPP + Sbjct: 53 PGISAFPEEDNIFCWKGTITGSKDTVFEGTEYRLSLSFSNDYPFKPPKV 101 >At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative strong similarity to SP|P50550 Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO- 1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) {Xenopus laevis}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 160 Score = 39.9 bits (89), Expect = 0.001 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 8/81 (9%) Frame = +3 Query: 15 KNDPVPYV----TAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYM 182 KN P +V T + N++ WH + G + +EGG++ + F ++P KPP Sbjct: 19 KNHPHGFVAKPETGQDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPSKPPKCKF 78 Query: 183 ITPNGRFKTNT----RLCLSI 233 P G F N +CLSI Sbjct: 79 --PQGFFHPNVYPSGTVCLSI 97 >At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 120 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +3 Query: 72 WHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP--NGRFKTNTRLCLSI 233 ++ ++ GP +SPYEGG + ++ P E+P P + +T + R+CL I Sbjct: 4 FNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDI 59 >At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative similar to SP|Q16763 Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) {Homo sapiens}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 251 Score = 38.7 bits (86), Expect = 0.003 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 4/62 (6%) Frame = +3 Query: 84 VKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP--NGRFKTNTRLCLSI--TDFHPD 251 ++GP +PYE G + K+ +FP PP Y +T + +N +C++ D++P Sbjct: 46 IEGPVGTPYENGLFRMKLALSHDFPHSPPKGYFMTKIFHPNVASNGEICVNTLKKDWNPS 105 Query: 252 TG 257 G Sbjct: 106 LG 107 >At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19) nearly identical to ubiquitin-conjugating enzyme UBC19 [Arabidopsis thaliana] GI:22530865; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 181 Score = 37.5 bits (83), Expect = 0.007 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 30 PYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSI 176 P ++A P NI W + G + + +EG Y + F ++PFK P + Sbjct: 54 PGISAFPEEDNIFCWKGTITGSKDTVFEGTEYRLSLTFSNDYPFKSPKV 102 >At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin conjugating enzyme [Lycopersicon esculentum] GI:886679; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 192 Score = 37.1 bits (82), Expect = 0.009 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 48 PVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMIT 188 P N+ + GP +PYEGG + I P +PF+PP + T Sbjct: 27 PKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPPKMQFST 73 >At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E2; identical to gi:431265, SP:P42748 Length = 187 Score = 37.1 bits (82), Expect = 0.009 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +3 Query: 45 EPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMIT 188 E + + E++ GP+ S Y+GG + ++ P +P+K PS+ IT Sbjct: 23 ETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYPYKSPSVGFIT 70 >At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E2; identical to gi:431269, SP:P42749 Length = 185 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +3 Query: 45 EPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMIT 188 E + + E+ GP+ S YEGG + ++ P +P+K PS+ IT Sbjct: 23 EMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYPYKSPSVGFIT 70 >At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family protein similar to ubiquitin-conjugating enzyme GB:3319990 from [Mus musculus]; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1163 Score = 34.3 bits (75), Expect = 0.063 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 4/78 (5%) Frame = +3 Query: 12 LKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 191 L+ND ++ S + V+ G E +PY G + I FP +P PP+++ + Sbjct: 283 LENDLPEAISVRACESRMDLLRAVIIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVHYHSG 342 Query: 192 NGRFKTNT----RLCLSI 233 R N ++CLS+ Sbjct: 343 GLRINPNLYNCGKVCLSL 360 Score = 34.3 bits (75), Expect = 0.063 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 81 VVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITPNGRFKTNTRLC 224 V+ G E +PY G + I FP +P PP++Y + R N C Sbjct: 952 VIIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVYYHSGGLRINPNLYNC 999 Score = 32.3 bits (70), Expect = 0.25 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 81 VVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITPNGRFKTNTRLC 224 V+ G E +PY G + I FP +P PP ++ + R N C Sbjct: 640 VIIGAEGTPYHDGLFFFDIQFPDTYPSVPPKVHYHSGGLRINPNLYKC 687 >At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E2; identical to gi|431267, SP:P42750, PIR:S52661; contains a ubiquitin-conjugating enzymes active site (PDOC00163) Length = 183 Score = 33.9 bits (74), Expect = 0.083 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 66 LEWHYVV-KGPEKSPYEGGYYHGKIIFPREFPFKPPSI 176 L+ YV GP S Y+GG + K+ P +P+K PS+ Sbjct: 29 LQMFYVTFHGPTDSLYQGGVWKIKVELPEAYPYKSPSV 66 >At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 907 Score = 33.9 bits (74), Expect = 0.083 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = +3 Query: 90 GPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITPNGRFKTNT----RLCLSITDFHPDTG 257 G +PY G + I+ P ++P +PP ++ + R N R+CLS+ + +G Sbjct: 700 GAPGTPYHDGLFFFDIMLPPQYPHEPPMVHYHSGGMRLNPNLYESGRVCLSLLNTWSGSG 759 Query: 258 T 260 T Sbjct: 760 T 760 >At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 31.9 bits (69), Expect = 0.33 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 72 WHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSI 176 W + GP + +EG Y K+ +++P KPP++ Sbjct: 49 WTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTV 83 >At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related similar to ubiquitin-conjugating enzyme (GI:3319990) [Mus musculus]; similar to Baculoviral IAP repeat-containing protein 6 (Ubiquitin-conjugating BIR-domain enzyme apollon) (Swiss-Prot:Q9NR09) [Homo sapiens]; Length = 609 Score = 31.9 bits (69), Expect = 0.33 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +3 Query: 81 VVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITPNGRFKTNT----RLCLSI 233 V+ G + +PY G + I FP +P PP ++ + R N ++CLS+ Sbjct: 367 VIIGAQGTPYHDGLFFFDIFFPDTYPSTPPIVHYHSGGLRINPNLYNCGKVCLSL 421 >At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 145 Score = 31.9 bits (69), Expect = 0.33 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 72 WHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSI 176 W + GP + +EG Y K+ +++P KPP++ Sbjct: 48 WTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTV 82 >At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 158 Score = 31.5 bits (68), Expect = 0.44 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +3 Query: 72 WHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSI 176 W + GP + YEG + K+ +E+P PP++ Sbjct: 47 WTGTILGPPNTAYEGKIFQLKLFCGKEYPESPPTV 81 >At5g03470.1 68418.m00303 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B' (B'alpha) similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 495 Score = 31.1 bits (67), Expect = 0.58 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 368 AAESLEINIKNKMFCELFPEYVEEIEQQLKQRQ 466 A L NIK +MF E+ PE EE +QQ +++Q Sbjct: 431 AVHGLSANIK-RMFMEMDPELFEECQQQYEEKQ 462 >At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1102 Score = 30.7 bits (66), Expect = 0.77 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +3 Query: 81 VVKGPEKSPYEGGYYHGKIIFPREFPFKPPSIYMITPNGRFKTNT----RLCLSI 233 V+ G +PY+ G + P ++P PPS Y + R N ++CLS+ Sbjct: 885 VIVGAFGTPYQDGLFFFDFHLPSDYPSVPPSAYYHSGGWRLNPNLYEEGKVCLSL 939 >At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 159 Score = 30.7 bits (66), Expect = 0.77 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 72 WHYVVKGPEKSPYEGGYYHGKIIFPREFPFKPPSI 176 W + GP + YEG + K+ +++P PP++ Sbjct: 47 WTGTILGPHNTAYEGKIFQLKLFCGKDYPESPPTV 81 >At2g39740.1 68415.m04880 expressed protein Length = 474 Score = 30.3 bits (65), Expect = 1.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 31 HMLRPNLCRPTYWNGITSLKGRRKVPTKG 117 HM N RP Y NG+ S + K+P++G Sbjct: 436 HMNGVNSARPAYTNGVNSARPPSKIPSQG 464 >At5g59460.1 68418.m07452 scarecrow-like transcription factor 11 (SCL11) identical to cDNA scarecrow-like 11 (SCL11) mRNA, partial cds gi:4580526 Length = 172 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Frame = +3 Query: 189 PNGRF---KTNTRLCLSITDFHPDTGTLLG 269 PNG F +T + C+ ITD+ P G LLG Sbjct: 33 PNGSFPSLRTVAKKCVVITDWDPQPGALLG 62 >At4g22400.1 68417.m03237 expressed protein Length = 327 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/70 (25%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Frame = +2 Query: 203 QDKHTIVPQYYRLSSGHWNPAWSISTIL-TGLL-SFMLEK-TPTLGSIETSEYQKRC-LA 370 +D +T++ Y +SG W WS++++L G+ ++ +E +P+ I + KR Sbjct: 182 RDTYTLLIYYVAKTSGRWEQNWSVASMLVVGIFDTWYIESISPSPDKISIEIWPKRYDFT 241 Query: 371 AESLEINIKN 400 ++ E N+ N Sbjct: 242 FQTQEWNVSN 251 >At3g60630.1 68416.m06784 scarecrow transcription factor family protein scarecrow-like 6, Arabidopsis thaliana, EMBL:AF036303 Length = 623 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = -3 Query: 233 NTEAQSCV---CLEPAIRCYHVNR-RWFERKFPWEN 138 N EA + + C++P+I+ NR RW ER PW + Sbjct: 527 NAEAATSIERFCVQPSIQKLLTNRYRWMERSPPWRS 562 >At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16) E2; identical to gi:2801444, GB:AAC39325 from [Arabidopsis thaliana] (Plant Mol. Biol. 23 (2), 387-396 (1993)) Length = 161 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +2 Query: 254 WNPAWSISTILTGLLSFMLEKTPTLGSIETSEYQKRC 364 W+PA ++S+I +LS + T + Y K C Sbjct: 107 WSPAMTVSSICISILSMLSSSTEKQRPTDNDRYVKNC 143 >At4g19190.1 68417.m02832 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 595 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 6 LRLK-NDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGY 122 LRLK +DP+ + A PS L+W K P SP GG+ Sbjct: 240 LRLKRDDPLTAIIAHTDPSEPLKWELKQK-PGLSPPRGGF 278 >At3g44610.1 68416.m04796 protein kinase family protein similar to viroid symptom modulation protein (protein kinase)[Lycopersicon esculentum] gi|7672777|gb|AAF66637; contains protein kinase domain, Pfam:PF00069 Length = 451 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 3/65 (4%) Frame = -3 Query: 230 TEAQSCV---CLEPAIRCYHVNRRWFERKFPWENNLSMIISPFVGTFLRPFNDVMPFQYV 60 T + SC+ C+ PA+ C+H R ++K NN +++ V DV +V Sbjct: 263 TTSSSCMIPNCIVPAVSCFHPRIRRRKKKTDHRNNGPELVAEPV--------DVRSMSFV 314 Query: 59 GRHRF 45 G H + Sbjct: 315 GTHEY 319 >At5g54880.1 68418.m06836 DTW domain-containing protein contains Pfam domain, PF03942: DTW domain Length = 394 Score = 27.5 bits (58), Expect = 7.2 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 2/83 (2%) Frame = +2 Query: 146 KGISVQTTFDLHDNTEWQVQDKHTIVPQYYRLSSGHWNPAWSISTILTGLLSFMLEKTPT 325 K + V T FD+HD E+ ++ I ++ + H + + + + + L K + Sbjct: 98 KNVGVTTVFDVHDEAEFLIR---VIGSGCSKIDTNHLDSEYRVENVASLELDDSF-KLGS 153 Query: 326 LGSIETSEYQKRCLAAE--SLEI 388 G++E E +K + + SLEI Sbjct: 154 SGNVENLESEKNVVLVDHGSLEI 176 >At3g52560.2 68416.m05785 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 147 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 72 WHYVVKGPEK-SPYEGGYYHGKIIFPREFPFKPPSI 176 W + GP + +EG Y K+ +++P KPP++ Sbjct: 49 WTGTIIGPHNVTVHEGRIYQLKLFCDKDYPEKPPTV 84 >At2g42700.1 68415.m05287 expressed protein Length = 788 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/67 (22%), Positives = 35/67 (52%) Frame = +2 Query: 287 TGLLSFMLEKTPTLGSIETSEYQKRCLAAESLEINIKNKMFCELFPEYVEEIEQQLKQRQ 466 T L M+++ GS+ ++ + L E++ +N++ + PE ++ + + L Q Q Sbjct: 376 TPYLEAMIDRKTKDGSVLVKKWLQEALRRENISVNVRARPGYATKPE-LQAMIKALSQSQ 434 Query: 467 EAMLLNQ 487 ++L N+ Sbjct: 435 SSLLKNK 441 >At2g36060.2 68415.m04428 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 72 WHYVVKGPEK-SPYEGGYYHGKIIFPREFPFKPPSI 176 W + GP + +EG Y K+ +++P KPP++ Sbjct: 48 WTGTIIGPHNVTVHEGRIYQLKLFCDKDYPEKPPTV 83 >At1g56030.1 68414.m06433 MIF4G domain-containing protein / U-box domain-containing protein low similarity to intermediate filament filarin [Hirudo medicinalis] GI:4761082; contains Pfam profiles PF02854: MIF4G domain, PF04564: U-box domain Length = 371 Score = 27.5 bits (58), Expect = 7.2 Identities = 8/23 (34%), Positives = 18/23 (78%) Frame = +2 Query: 95 GEKSLRRGILSWKDYFPKGISVQ 163 G+K+L+ +++WKD + +G S++ Sbjct: 250 GQKNLKSQVITWKDKYDQGSSIR 272 >At1g23670.2 68414.m02987 expressed protein contains Pfam profile PF02713: Domain of unknown function DUF220 Length = 264 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 389 NIKNKMFCELFPEYVEEIEQQLK 457 N+K K E +PE EE+++QLK Sbjct: 25 NVKTKSVSETYPENREELKKQLK 47 >At1g23670.1 68414.m02986 expressed protein contains Pfam profile PF02713: Domain of unknown function DUF220 Length = 219 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 389 NIKNKMFCELFPEYVEEIEQQLK 457 N+K K E +PE EE+++QLK Sbjct: 25 NVKTKSVSETYPENREELKKQLK 47 >At1g10340.2 68414.m01165 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 574 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -3 Query: 566 LQDQPDLSKXQ-FILDCGSEVLHLHHCLDSTTLPLVVVLIAVQSPL 432 L+ PDL++ + ++++ GS+ LHH D L +L+ + L Sbjct: 148 LERFPDLAREEAWVVEDGSQSTLLHHACDKGDFELTTILLGLDQGL 193 >At1g10340.1 68414.m01164 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 578 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -3 Query: 566 LQDQPDLSKXQ-FILDCGSEVLHLHHCLDSTTLPLVVVLIAVQSPL 432 L+ PDL++ + ++++ GS+ LHH D L +L+ + L Sbjct: 152 LERFPDLAREEAWVVEDGSQSTLLHHACDKGDFELTTILLGLDQGL 197 >At1g04910.1 68414.m00488 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'growth regulator protein' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 519 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +1 Query: 25 QYHMLRPNLCRPTYWNGITSLKGRRKVPTKGDIIMERLFSQGNFRSNHLRF 177 +Y LR CR Y +L+ + + + I+++L SQG+F S HLRF Sbjct: 220 EYQRLR---CRVNYH----ALRFKPHIMKLSESIVDKLRSQGHFMSIHLRF 263 >At5g63810.1 68418.m08008 beta-galactosidase, putative / lactase, putative similar to beta-galactosidase GI:7939621 from [Lycopersicon esculentum]; contains Pfam profile PF01301: Glycosyl hydrolases family 35 Length = 741 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 209 CLEPAIRCYHVNRRWFE 159 C EP+ R YHV R WF+ Sbjct: 696 CGEPSQRWYHVPRSWFK 712 >At1g75800.1 68414.m08805 pathogenesis-related thaumatin family protein similar to receptor serine/threonine kinase PR5K [Arabidopsis thaliana] GI:1235680; contains Pfam profile: PF00314 Thaumatin family Length = 330 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 10 GSRMTQYHMLRPNLCRPTYWNGITSLKGRRKVPTKGDIIME 132 G R T + M+ N C T W G+ S G +PT G ++ + Sbjct: 19 GVRSTSFIMV--NKCEYTVWPGLLSNAGVPPLPTTGFVLQK 57 >At1g22260.1 68414.m02782 expressed protein Length = 857 Score = 27.1 bits (57), Expect = 9.5 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 4/70 (5%) Frame = +2 Query: 311 EKTPTLGSIETSEYQKRCLAAESLEINIKNKMFCELF----PEYVEEIEQQLKQRQEAML 478 E L S++TSE +K+ L+ + + +++K CE VEE+E L++ E+ Sbjct: 420 EMETLLESVKTSEDKKQELSLKLSSLEMESKEKCEKLQADAQRQVEELE-TLQKESESHQ 478 Query: 479 LNQDSGANEV 508 L D A EV Sbjct: 479 LQADLLAKEV 488 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,105,501 Number of Sequences: 28952 Number of extensions: 321721 Number of successful extensions: 1082 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 1008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1082 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -