BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1163 (299 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48154| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.30 SB_51975| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.92 SB_23131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.2 SB_7587| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-13) 28 1.2 SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.1 SB_59058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.1 SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) 27 2.1 SB_25773| Best HMM Match : 7tm_1 (HMM E-Value=1.68156e-44) 27 2.8 SB_39407| Best HMM Match : TIG (HMM E-Value=0) 27 3.7 SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17) 26 4.9 SB_148| Best HMM Match : PRKCSH (HMM E-Value=2.4) 26 4.9 SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) 26 6.5 SB_40233| Best HMM Match : Ion_trans_2 (HMM E-Value=1.4e-23) 25 8.6 SB_33036| Best HMM Match : Ion_trans_2 (HMM E-Value=3e-08) 25 8.6 SB_23062| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.6 >SB_48154| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 30.3 bits (65), Expect = 0.30 Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +2 Query: 125 HAKYTCSFCGKDAMKRSCVGIWSCKRCK--RTVAGGAWVFSTTAAYHAD 265 HA Y CS ++ +K + + K R + WV T + YH + Sbjct: 64 HASYLCSLKRRELLKPNIAQAYQAHHIKNWRKITSDPWVLETASGYHLE 112 >SB_51975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 28.7 bits (61), Expect = 0.92 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 13 EVYQNGQXYQKGWNYWQIWHTLRCL 87 + YQ + GW WQIW LR + Sbjct: 644 DTYQGRPLMKYGWLKWQIWRALRLI 668 >SB_23131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.3 bits (60), Expect = 1.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 38 TKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTC 142 T+ GIT T Y +S +K+V + T+ A TC Sbjct: 19 TRWSGITCMMSTHYSSSYKKLVPRQLTTRWASITC 53 >SB_7587| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-13) Length = 351 Score = 28.3 bits (60), Expect = 1.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 80 GASLRKMVKKMEVTQHAKYTCSFCGK 157 G +K ++ E++ H KY CS CGK Sbjct: 210 GGVTKKQIQSNEIS-HKKYVCSTCGK 234 >SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 27.5 bits (58), Expect = 2.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 159 SLPQNEQVYFACWVTSIFLTIL 94 S P + V FA W SIFLTI+ Sbjct: 133 SAPTSLSVIFAAWFLSIFLTII 154 >SB_59058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 27.5 bits (58), Expect = 2.1 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -3 Query: 177 QERFIASLPQNEQVYFACWVTSIFLTILRRE 85 +++ AS + E ++ CWV S F+T + + Sbjct: 167 RKKIAASCWEKESEFYECWVASFFITTAKTQ 197 >SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) Length = 298 Score = 27.5 bits (58), Expect = 2.1 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 137 TCSFCGKDAMKRS 175 TC+FCGKDA K S Sbjct: 243 TCNFCGKDARKTS 255 >SB_25773| Best HMM Match : 7tm_1 (HMM E-Value=1.68156e-44) Length = 906 Score = 27.1 bits (57), Expect = 2.8 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Frame = -3 Query: 291 YFT*PPDSRSA**AAVVENTQAPPATVLLHRLQDQMPTQERFIASLPQNEQVYF-ACWVT 115 Y+ P + S+ A N PA + L+D + + +LPQN +++ AC V+ Sbjct: 324 YYEYSPGAASSKIIATDSNANDEPANHVQLELEDPCAVNTK-LTTLPQNSRMFILACKVS 382 Query: 114 SIFLTILRREAP 79 + I AP Sbjct: 383 WVVFNIAANVAP 394 >SB_39407| Best HMM Match : TIG (HMM E-Value=0) Length = 1710 Score = 26.6 bits (56), Expect = 3.7 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = +2 Query: 5 VSERFTKMAXRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGK 157 +S +TK+ RT+K I GKY +++ V YT S K Sbjct: 1245 MSSSYTKIICRTQKSHIPGKYNVSVSVGVQQCACTSHVGCSFAYTTSLTPK 1295 >SB_50779| Best HMM Match : DUF885 (HMM E-Value=1.4e-17) Length = 815 Score = 26.2 bits (55), Expect = 4.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 13 EVYQNGQXYQKGWNYWQIWHTLRCL 87 +VY+N + G WQIW LR + Sbjct: 643 DVYRNEPLQRYGMLKWQIWRALRLI 667 >SB_148| Best HMM Match : PRKCSH (HMM E-Value=2.4) Length = 438 Score = 26.2 bits (55), Expect = 4.9 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -1 Query: 230 KLLLLQSSCIAYKTRCRHKNVS*HPYHKMSKYTLRVGL 117 +++ LQS YK C KNV HP Y LR+GL Sbjct: 110 RVVTLQSDSYPYK--CYIKNVLSHPQESQESY-LRLGL 144 >SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 618 Score = 25.8 bits (54), Expect = 6.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 92 RKMVKKMEVTQHAKYTCSFCGKDAMKRS 175 R+ VK + + + KY C C KD + S Sbjct: 410 REQVKDLFIKEGEKYRCRLCSKDFTRLS 437 >SB_40233| Best HMM Match : Ion_trans_2 (HMM E-Value=1.4e-23) Length = 750 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 176 CVGIWSCKRCKRTVAGG--AWVFSTTAAYHADLLSGGYVK 289 C+G W + T G AW + T + D++ GG+ K Sbjct: 620 CIGAWIYTNEEGTYLEGTYAWFITFTTIGYGDIVPGGHSK 659 >SB_33036| Best HMM Match : Ion_trans_2 (HMM E-Value=3e-08) Length = 298 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 176 CVGIWSCKRCKRTVAGG--AWVFSTTAAYHADLLSGGYVK 289 C+G W + T G AW + T + D++ GG+ K Sbjct: 168 CIGAWIYTNEEGTYLEGTYAWFITFTTIGYGDIVPGGHSK 207 >SB_23062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 25.4 bits (53), Expect = 8.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 13 EVYQNGQXYQKGWNYWQIWHTLRCL 87 +VYQ + + G WQIW LR + Sbjct: 558 DVYQVNKLQKFGMLKWQIWRALRLI 582 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,945,746 Number of Sequences: 59808 Number of extensions: 198488 Number of successful extensions: 553 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 352102492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -