BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1156 (538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 4e-24 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 37 0.012 SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) 36 0.021 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 34 0.064 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 34 0.064 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 33 0.11 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.11 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.20 SB_42066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_2108| Best HMM Match : DUF702 (HMM E-Value=4.7) 30 1.0 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 30 1.4 SB_47196| Best HMM Match : Extensin_2 (HMM E-Value=0.02) 29 1.8 SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) 29 1.8 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 2.4 SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) 29 2.4 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 29 3.2 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 29 3.2 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_38878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 28 4.2 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 28 5.6 SB_20454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 27 7.3 SB_43550| Best HMM Match : Laminin_EGF (HMM E-Value=0) 27 7.3 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 27 9.7 SB_27892| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 107 bits (258), Expect = 4e-24 Identities = 53/91 (58%), Positives = 60/91 (65%) Frame = +1 Query: 94 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFSS 273 R PP IDGM SLKVDNLTYRTT EDL++VF++ G++GDIYIPRDR T ESRGFA F Sbjct: 7 RGPPEIDGMTSLKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYE 66 Query: 274 VVTLKKPWTRWTDECWTAGNFAFRWRDMVAP 366 + C A F FRWRDMV P Sbjct: 67 KRDAEDAMDCMDATCLMAEKFVFRWRDMVVP 97 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +1 Query: 133 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 V NL Y T DL +VFER G+V + I RD+ TRESRG A Sbjct: 14 VGNLPYSLTNSDLHKVFERYGKVVKVTILRDKETRESRGVA 54 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 38.7 bits (86), Expect = 0.003 Identities = 24/56 (42%), Positives = 29/56 (51%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFSSVVTLKK 291 SL V NL+Y TT + L FE C I+ DR + ESRGF + V T KK Sbjct: 290 SLIVRNLSYDTTTDSLGAAFEGCSNAKVIF---DRESGESRGFGFVDYDDVETAKK 342 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 37.9 bits (84), Expect = 0.005 Identities = 20/47 (42%), Positives = 25/47 (53%) Frame = +1 Query: 112 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 D L V L TT E LR FE GE+ D+ + D T++SRGF Sbjct: 11 DPRAKLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGF 57 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 36.7 bits (81), Expect = 0.012 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +1 Query: 112 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 D + L V L+Y TT E L+ F + GE+ + I D T RGFA Sbjct: 26 DDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFA 73 >SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) Length = 97 Score = 35.9 bits (79), Expect = 0.021 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 151 RTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 R ED+R FE+ G + D+++ +D+ T+E+RG Sbjct: 33 RHNAEDIRSAFEQYGTIEDVWVVKDKATKENRG 65 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 34.3 bits (75), Expect = 0.064 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +1 Query: 112 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 D S+ + NL + E LR +F CG V + + RDR T +GF Sbjct: 53 DHQRSVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGF 99 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 34.3 bits (75), Expect = 0.064 Identities = 21/60 (35%), Positives = 32/60 (53%) Frame = +1 Query: 73 LLKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 +L + YG + L V LT + + E LR+ FE+ GE+ + + RD T+ SRGF Sbjct: 95 ILDIDYGTS--HFSSTLELSVIPLT-QASAEGLRQHFEKFGELKECVVMRDPVTKRSRGF 151 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 33.5 bits (73), Expect = 0.11 Identities = 16/52 (30%), Positives = 31/52 (59%) Frame = +1 Query: 127 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFSSVVT 282 L V + Y + + LR+ F + GE+ + + +DR T++S+G+ GF ++ T Sbjct: 12 LFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGY---GFVTMAT 60 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 160 PEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 P DL F + G+V D+ I DR +R S+G A Sbjct: 159 PRDLEEFFSKVGQVSDVRIISDRNSRRSKGIA 190 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/59 (27%), Positives = 25/59 (42%) Frame = +1 Query: 115 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFSSVVTLKK 291 G L V +L + T ++ VFE G V + + D T S+G+ F K+ Sbjct: 240 GPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKR 298 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 33.1 bits (72), Expect = 0.15 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +1 Query: 127 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 L V L Y TT +++ F R GE+ + D TR SRGF Sbjct: 117 LIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGF 158 Score = 31.5 bits (68), Expect = 0.45 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 73 LLKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPR 222 L ++ RP ++ L V L TT + L F + GEV D+YIP+ Sbjct: 183 LCEVRLPRPKEELNVPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPK 232 >SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 32.7 bits (71), Expect = 0.20 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 163 EDLRRVFERCGEVGDIYIPRDRYTRESRGF 252 EDLR FE G++ + I RD TRE++G+ Sbjct: 67 EDLRSKFESFGDIEYVQIVRDHKTRENKGY 96 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 32.7 bits (71), Expect = 0.20 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 +L VDNL+ T D+ R F G+V ++I DR T +S+G Sbjct: 320 TLFVDNLSEDTKELDVLRYFRPYGQVAKVHILTDRETGKSKG 361 Score = 31.1 bits (67), Expect = 0.60 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 127 LKVDNLTYRTTPEDLRRVFERCGEVGDI 210 L V +L + TT ++LR FE+CGE+ I Sbjct: 238 LMVQDLDFDTTVDELREYFEKCGELTGI 265 >SB_42066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 30.7 bits (66), Expect = 0.79 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +1 Query: 121 VSLKVDNLTYR--TTPEDLRRVFERCGEVGDI-YIPRDR 228 +S+K +N R T E+L +FE CG+V D ++P+DR Sbjct: 147 LSVKYNNDKTRESVTEEELTSMFEDCGDVADFRFLPKDR 185 >SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2286 Score = 30.3 bits (65), Expect = 1.0 Identities = 27/95 (28%), Positives = 40/95 (42%) Frame = +1 Query: 40 FNLFDLS*ISILLKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 219 F+L DL + + L + R P IDG S ++ +T + G V +Y+ Sbjct: 98 FSLEDLFPVRLDLTAA-NRSPIAIDGAFSARLSTITRDGEAVSCSSMVYVSGSVQAMYLS 156 Query: 220 RDRYTRESRGFAS*GFSSVVTLKKPWTRWTDECWT 324 + +RG S GF S LK P TD+ T Sbjct: 157 YESML--NRGILSHGFPSAEPLKNPSDEHTDDSAT 189 >SB_2108| Best HMM Match : DUF702 (HMM E-Value=4.7) Length = 297 Score = 30.3 bits (65), Expect = 1.0 Identities = 27/95 (28%), Positives = 40/95 (42%) Frame = +1 Query: 40 FNLFDLS*ISILLKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 219 F+L DL + + L + R P IDG ++ +T R + G V +Y+ Sbjct: 152 FSLEDLFPVRLDLTAA-NRSPIAIDGAFFARLSTITRDGEAVSCRSMVYVSGSVQAMYLS 210 Query: 220 RDRYTRESRGFAS*GFSSVVTLKKPWTRWTDECWT 324 + +RG S GF S LK P TD+ T Sbjct: 211 YESML--NRGILSHGFPSAEPLKNPSDEHTDDSAT 243 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 127 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 L V +LT + ++ +F G V + +P DR SRGFA Sbjct: 1159 LYVAHLTRNVNKDHVQEIFSVYGRVKTVDLPTDRTNNLSRGFA 1201 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 279 DAEEALDTMDGRMLDGRELRVQ 344 + E+AL MDG +DG+E+ VQ Sbjct: 1210 ECEKALKHMDGGQIDGQEIAVQ 1231 >SB_47196| Best HMM Match : Extensin_2 (HMM E-Value=0.02) Length = 376 Score = 29.5 bits (63), Expect = 1.8 Identities = 23/64 (35%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +1 Query: 115 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPR-DRYTRESRGFAS*GFSSVVTLKK 291 G LK+ LT TP D+ R G+ D IPR R + RG S +KK Sbjct: 155 GRRQLKISLLTEPDTPVDIARARSPRGQEQDPKIPRGQRQNQTPRGQRQSKIPSQRHIKK 214 Query: 292 -PWT 300 PWT Sbjct: 215 LPWT 218 >SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) Length = 193 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -2 Query: 396 CDRNDSCMAMRGDHIAPSEREVP--CRPTFVRPSCP 295 C+ +D C G+ P E E P CR T + SCP Sbjct: 27 CNSDDKCSP--GERCRPQENECPLKCRKTIKKKSCP 60 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 124 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPR 222 +L V N+ TT DL+ FER GEV D+ I + Sbjct: 250 TLFVGNIEKTTTYGDLKEAFERYGEVIDVDIKK 282 >SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) Length = 694 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +1 Query: 127 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRE 240 L V L+ TT DLR VFE+ G V I I D +E Sbjct: 183 LGVFGLSLYTTERDLRPVFEKYGPVEAIQIVYDHQAKE 220 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = -2 Query: 405 TCACDRNDSCMAMRGDHIAPSEREVPCRPTFVRPSCPGLLQRHDARKTSRSESSTFPCVP 226 TC C +++C+A RG+ + S + T+ S R + S+S S T Sbjct: 1110 TCDCGEDETCVACRGEKHSDSTHALEDYTTYSIASSSRRFSRGSSENLSKSASVTSSTES 1169 Query: 225 IS 220 IS Sbjct: 1170 IS 1171 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 112 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 D +L ++ + + ED++++F G V + RDR T +S G+A Sbjct: 24 DERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYA 71 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +1 Query: 91 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESR 246 G R V L V + +DLR +FE G++ ++ I +D+YT + + Sbjct: 160 GTTSVRDSNSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHK 211 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 181 FERCGEVGDIYIPRDRYTRESRGFAS*GFSSV 276 F GE+ +YIP + T+E +G F+SV Sbjct: 141 FSSSGEIASVYIPENLKTKERKGHCIVTFASV 172 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 28.7 bits (61), Expect = 3.2 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +3 Query: 279 DAEEALDTMDGRMLDGRELRVQMA 350 DAE+A+ +DGR + G+ +RV++A Sbjct: 80 DAEDAVRELDGRYICGQRVRVELA 103 >SB_38878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -2 Query: 429 YDGGNETWTCACD---RNDSCMAMRGDHIAPSEREVPCR 322 YDG T D ND + M G H AP R++ C+ Sbjct: 332 YDGDRNTQIALMDMPHENDVVVEMNGRHAAPRHRKIRCQ 370 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 136 DNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAS*GFSS 273 + L + + L++VF G+V + +PR ++ E +GFA F S Sbjct: 93 EKLPFHADHDWLKKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEFES 138 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 154 TTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 TT EDL +F R G + + RD+ T ES +A Sbjct: 131 TTDEDLEIIFSRFGTILSCEVIRDQKTGESLQYA 164 >SB_20454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 27.9 bits (59), Expect = 5.6 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +1 Query: 76 LKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 249 LK + GR P D + + D+ + DLR RCG +P D+ R ++G Sbjct: 485 LKQTGGRIPENKDSLGRDRRDSCGTKEL-RDLRDAIRRCGVTDSPTVPDDKGKRNAKG 541 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 76 LKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCG 195 +K+S+ R P+I S V T TTPE+LR++ E G Sbjct: 1522 MKLSF-RTGPQIGRTKSGFVATYTSGTTPEELRKISENAG 1560 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 5.6 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +3 Query: 279 DAEEALDTMDGRMLDGRELRVQMA 350 DAE+A+ +DGR + G+ RV++A Sbjct: 50 DAEDAVRELDGRYICGQRARVELA 73 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +1 Query: 109 IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFA 255 ++G + L V N+ +D+ +F GE+ ++++ DR T +G+A Sbjct: 290 VEGWI-LFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYA 337 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 27.5 bits (58), Expect = 7.3 Identities = 23/92 (25%), Positives = 34/92 (36%), Gaps = 2/92 (2%) Frame = -2 Query: 474 RPARTGCGLRTCASNYDGGNETWTCACDRNDSCMAMR--GDHIAPSEREVPCRPTFVRPS 301 R A+ CG + CAS G + C + C + G + P V P V P Sbjct: 2273 RCAQICCGYKGCASALMLGGRCYNLICFSEEQCHLRKSSGSFMVPKFVHVRASPLVVLPG 2332 Query: 300 CPGLLQRHDARKTSRSESSTFPCVPISGNVDI 205 GL + S E S P + I ++ + Sbjct: 2333 -NGLTVQSTNNFNSSLEQSAEPSLGILRDISL 2363 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 279 DAEEALDTMDGRMLDGRELRVQMA 350 + E+A+D DG+ LDGR ++V A Sbjct: 149 EMEKAIDEFDGQDLDGRPMKVNEA 172 >SB_43550| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1182 Score = 27.5 bits (58), Expect = 7.3 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -2 Query: 444 TCASNYDGGNETWTCACDRNDSCMAMRGDHIA-PSEREVPCRPTFVRPSC 298 T + YDGGN TC CD + G + P + C+ + C Sbjct: 217 TNKNKYDGGNNDDTCNCDPKGTQRDANGTLVCDPIGGQCKCKSNVIGQRC 266 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +1 Query: 88 YGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEV 201 YG PP R + S+ V+NL+ RT+ +DL+ F + G+V Sbjct: 790 YG-PPVRTN--YSVIVENLSSRTSWQDLKDYFRKYGKV 824 >SB_27892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1441 Score = 27.1 bits (57), Expect = 9.7 Identities = 26/95 (27%), Positives = 39/95 (41%) Frame = +1 Query: 40 FNLFDLS*ISILLKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 219 F+L DL + + L + R P IDG ++ +T R + G V +Y+ Sbjct: 409 FSLEDLFPVRLDLTAA-NRSPIAIDGAFFARLSTITRDGEAVPCRSMVYVSGSVQAMYLS 467 Query: 220 RDRYTRESRGFAS*GFSSVVTLKKPWTRWTDECWT 324 + + G S GF S LK P TD+ T Sbjct: 468 YESML--NLGILSHGFPSAEPLKNPSDEHTDDLAT 500 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,668,702 Number of Sequences: 59808 Number of extensions: 280831 Number of successful extensions: 803 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 798 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -