BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1146 (250 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6ERK7 Cluster: Hyalin repeat protein; n=1; unidentifie... 37 0.074 UniRef50_A2QKC4 Cluster: Similarity to hypothetical protein enco... 30 8.5 >UniRef50_A6ERK7 Cluster: Hyalin repeat protein; n=1; unidentified eubacterium SCB49|Rep: Hyalin repeat protein - unidentified eubacterium SCB49 Length = 1008 Score = 37.1 bits (82), Expect = 0.074 Identities = 11/31 (35%), Positives = 23/31 (74%) Frame = -2 Query: 138 NXVKKYAFIFVVCFISTQSSHQRNEFSVMNN 46 N + +Y F+F++CF+ST ++ + N F+ +N+ Sbjct: 2 NKITQYVFVFIMCFLSTLNAQEENSFTSLNS 32 >UniRef50_A2QKC4 Cluster: Similarity to hypothetical protein encoded by An11g00040 - Aspergillus niger precursor; n=1; Aspergillus niger|Rep: Similarity to hypothetical protein encoded by An11g00040 - Aspergillus niger precursor - Aspergillus niger Length = 122 Score = 30.3 bits (65), Expect = 8.5 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 40 IYIIHNREFVSLMRRLCANKTDYKNKRIFFYXIL 141 ++ IH+RE+V RLC Y +FF ++ Sbjct: 86 VHYIHDREYVRFQNRLCKENRHYGANPLFFRRVI 119 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,749,218 Number of Sequences: 1657284 Number of extensions: 1926983 Number of successful extensions: 3072 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3072 length of database: 575,637,011 effective HSP length: 61 effective length of database: 474,542,687 effective search space used: 9965396427 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -