BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1146 (250 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88308-19|AAB42328.1| 1927|Caenorhabditis elegans Hypothetical p... 25 9.4 AF100669-7|AAK39263.2| 549|Caenorhabditis elegans Hypothetical ... 25 9.4 >U88308-19|AAB42328.1| 1927|Caenorhabditis elegans Hypothetical protein C32E8.11 protein. Length = 1927 Score = 24.6 bits (51), Expect = 9.4 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 114 IFVVCFISTQSSHQRNEFSVMNNV--YMSLLC 25 + V+C S + +RN FS++N + Y S LC Sbjct: 689 VLVLCAQSNATLWRRNGFSLINQIHNYFSPLC 720 >AF100669-7|AAK39263.2| 549|Caenorhabditis elegans Hypothetical protein R11E3.1 protein. Length = 549 Score = 24.6 bits (51), Expect = 9.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 49 IHNREFVSLMRRLCANKTDYKNK 117 +HN VS M L ++K+DY K Sbjct: 473 MHNAAAVSTMLNLASDKSDYNQK 495 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,182,826 Number of Sequences: 27780 Number of extensions: 52661 Number of successful extensions: 87 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 12,740,198 effective HSP length: 62 effective length of database: 11,017,838 effective search space used: 220356760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -