BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1145 (449 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.25 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.25 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.25 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.25 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 0.43 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 0.43 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 25 0.43 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 7.1 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 20 9.4 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 20 9.4 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 20 9.4 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.25 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 230 YVALVKM**IITFFIAVILVIQYFAFVLYK 141 Y+ L + + FF A+ILVIQ+ A + ++ Sbjct: 1320 YLQLEPIGLVFVFFFALILVIQFVAMLFHR 1349 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.25 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 230 YVALVKM**IITFFIAVILVIQYFAFVLYK 141 Y+ L + + FF A+ILVIQ+ A + ++ Sbjct: 1320 YLQLEPIGLVFVFFFALILVIQFVAMLFHR 1349 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.25 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 230 YVALVKM**IITFFIAVILVIQYFAFVLYK 141 Y+ L + + FF A+ILVIQ+ A + ++ Sbjct: 1320 YLQLEPIGLVFVFFFALILVIQFVAMLFHR 1349 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 25.4 bits (53), Expect = 0.25 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 230 YVALVKM**IITFFIAVILVIQYFAFVLYK 141 Y+ L + + FF A+ILVIQ+ A + ++ Sbjct: 1320 YLQLEPIGLVFVFFFALILVIQFVAMLFHR 1349 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.6 bits (51), Expect = 0.43 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = -1 Query: 230 YVALVKM**IITFFIAVILVIQYFAFVLYK 141 Y+ L + + F A+++VIQ+FA ++++ Sbjct: 1277 YLQLEPIGFVFLIFFALLMVIQFFAMMIHR 1306 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.6 bits (51), Expect = 0.43 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = -1 Query: 230 YVALVKM**IITFFIAVILVIQYFAFVLYK 141 Y+ L + + F A+++VIQ+FA ++++ Sbjct: 1277 YLQLEPIGFVFLIFFALLMVIQFFAMMIHR 1306 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 24.6 bits (51), Expect = 0.43 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 127 TNFIRLYNTKAKY*ITRITAIKNVII 204 T +I L N +AKY T I IKN +I Sbjct: 235 TLYIILTNNQAKYCTTLIGLIKNCVI 260 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 20.6 bits (41), Expect = 7.1 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = -2 Query: 445 VYRLFEQPKRKNGLEQQYXXIYFXQHNYMSFASV 344 +Y+ KRKN +F H Y ++++V Sbjct: 210 LYKEIFNGKRKNPNGCDIKATFFVSHKYTNYSAV 243 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -2 Query: 448 IVYRLFEQPKRKNGLE 401 + + LFE KRKN ++ Sbjct: 336 VPFDLFENKKRKNNIK 351 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 20.2 bits (40), Expect = 9.4 Identities = 6/25 (24%), Positives = 17/25 (68%) Frame = -1 Query: 203 IITFFIAVILVIQYFAFVLYKRIKF 129 I+ +FI +++ +QY ++ R+++ Sbjct: 185 ILPYFINLLMELQYCHYLNILRVRY 209 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 20.2 bits (40), Expect = 9.4 Identities = 6/25 (24%), Positives = 17/25 (68%) Frame = -1 Query: 203 IITFFIAVILVIQYFAFVLYKRIKF 129 I+ +FI +++ +QY ++ R+++ Sbjct: 185 ILPYFINLLMELQYCHYLNILRVRY 209 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,176 Number of Sequences: 336 Number of extensions: 909 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -