BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1139 (578 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57739| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_9743| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_10512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_57782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1) 29 3.6 SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_41099| Best HMM Match : VWA (HMM E-Value=0) 27 8.4 SB_26228| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35270| Best HMM Match : Jacalin (HMM E-Value=8.6) 27 8.4 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_24494| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_23919| Best HMM Match : Nanovirus_C8 (HMM E-Value=7.2) 27 8.4 >SB_57739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 32.7 bits (71), Expect = 0.22 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 6/89 (6%) Frame = +3 Query: 303 YIEDENVEFPTCCARLRCVVEVNGERI----VQTRGQPGELFPDKPWKGQQNEPIPAVV- 467 Y+ D C R+RC+ N R V TR + G + + + +PA+V Sbjct: 280 YVGDIKQNRMKCLVRVRCIHSANQHRASHVTVFTRQRVGNGLLQAVYNHEYEKCVPAIVL 339 Query: 468 -GMSGIQQTPVGGEPRVRRLLEYLTAEEQ 551 + ++Q V +PR RRLL+ +EQ Sbjct: 340 APVFAVEQGKVPVKPRGRRLLKKKDMDEQ 368 >SB_9743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 470 NERHPADTGRWRAQGQASPGIFNSRGAAD 556 N + AD G + +G+A G+FN +G AD Sbjct: 70 NNKGVADKGLFNNKGEADKGLFNDKGEAD 98 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 470 NERHPADTGRWRAQGQASPGIFNSRGAAD 556 N + AD G + +G+A G+FN++ AD Sbjct: 81 NNKGEADKGLFNDKGEADKGLFNNKRVAD 109 >SB_10512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +3 Query: 252 CGCRKPKIPENALECHEYIEDENVEFPTCCARLRC 356 C +KP +P++ HE + + C R RC Sbjct: 28 CLAQKPGVPQDTRHSHEPLPQRKISLIVCSTRTRC 62 >SB_57782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 119 SADRAGKTRQHNINNAPNCFPCCIL 45 SA+ K R H+ N +CF CCIL Sbjct: 279 SANDKKKKRLHDSANQKSCFTCCIL 303 >SB_54236| Best HMM Match : bZIP_1 (HMM E-Value=1.1) Length = 1188 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 270 KIPENALECHEYIEDENVEFPT 335 ++ E+ LEC EYI ++N EF T Sbjct: 513 EMSESILECFEYIPEKNTEFMT 534 >SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1981 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +3 Query: 225 QRREILHSCCGCRKPKIPENALECHEYIEDENVEFPTCC 341 QRRE + G K E H+ D NV F CC Sbjct: 731 QRREGFKTAEGSEARKQDERRFRLHQSSSDSNVYFSQCC 769 >SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1593 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 214 RCEIRDGKYFIAAVDVENQKYRKTHWNATNTSK 312 +C I G+Y+I + Q++R WNA +T++ Sbjct: 497 QCNIIHGRYYIFHHKKDVQRHRYLVWNANDTTR 529 >SB_41099| Best HMM Match : VWA (HMM E-Value=0) Length = 3373 Score = 27.5 bits (58), Expect = 8.4 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 Query: 335 VLCAIALRRRSKWRENSANQRAAWRTVPR*TMEGPTKR 448 V C R RE RA WR+VP + PTKR Sbjct: 3168 VACLQVFARVLNAREIQQRMRACWRSVPTKSPVVPTKR 3205 >SB_26228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 27.5 bits (58), Expect = 8.4 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 248 LLWMSKTKNTGKRTGM--PRIHRR*ECRIPHVLCAIALRRRSKWRENS 385 L W + KN GKR G+ P + R C + +A R R WREN+ Sbjct: 17 LSWNPEYKNPGKRNGIRNPEPYWR-SCH-EAMTYPLATRHRQIWRENA 62 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 Query: 487 CWMPLIPTTAGIGSFCWPFHGLSGNSSPGCPLV 389 CW A +CWP S + SPG PLV Sbjct: 26 CWPKGREFLAKRARYCWPKDIASNSCSPGDPLV 58 >SB_35270| Best HMM Match : Jacalin (HMM E-Value=8.6) Length = 211 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 121 DVSYQACVDKYSRKGYQPWQEWSDHYT 201 D SY D+ GY WQ W+D +T Sbjct: 144 DGSYPKPHDEALEAGYDSWQAWADAWT 170 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 27.5 bits (58), Expect = 8.4 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -1 Query: 488 LLDAAHSDNSRNWLVLLALPWFIGEQFARLPSGLHYSLSIYFDDAT 351 L+D++ S RNW +L I ++F P+G H ++ Y AT Sbjct: 4292 LIDSSGSIGRRNWARMLNFVTKIIDKFNVGPAGTHIAVVTYSTGAT 4337 >SB_24494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 272 NTGKRTGMPRIHRR*ECRIPHVLCAIA 352 + GK G IH R +CR P LC +A Sbjct: 373 SNGKLMGTIDIHSRRKCRNPRSLCVVA 399 >SB_23919| Best HMM Match : Nanovirus_C8 (HMM E-Value=7.2) Length = 308 Score = 27.5 bits (58), Expect = 8.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 216 MRDQRREILHSCCGCRKPKIPENAL 290 MR++R I+ +C C P P+N + Sbjct: 1 MRERRENIVRACENCETPSSPKNTM 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,671,190 Number of Sequences: 59808 Number of extensions: 440272 Number of successful extensions: 1300 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1299 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -