BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1133 (598 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99758-1|CAI22851.1| 376|Homo sapiens non-metastatic cells 7, p... 56 7e-08 BC006983-1|AAH06983.1| 376|Homo sapiens non-metastatic cells 7,... 56 7e-08 AL356852-1|CAI19238.1| 376|Homo sapiens non-metastatic cells 7,... 56 7e-08 AL031726-1|CAI18887.1| 376|Homo sapiens non-metastatic cells 7,... 56 7e-08 AF153191-1|AAD34622.1| 376|Homo sapiens nm23-H7 protein. 56 7e-08 AB209049-1|BAD92286.1| 283|Homo sapiens nucleoside-diphosphate ... 56 7e-08 >Z99758-1|CAI22851.1| 376|Homo sapiens non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) protein. Length = 376 Score = 56.4 bits (130), Expect = 7e-08 Identities = 27/73 (36%), Positives = 45/73 (61%) Frame = +3 Query: 255 DKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434 +++ F+ E YD +A ++ L ++P D SV++ D K + LKR + L+L+ L IGN Sbjct: 5 ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64 Query: 435 IVNIFSKLLYIKD 473 VN+FS+ L + D Sbjct: 65 KVNVFSRQLVLID 77 >BC006983-1|AAH06983.1| 376|Homo sapiens non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) protein. Length = 376 Score = 56.4 bits (130), Expect = 7e-08 Identities = 27/73 (36%), Positives = 45/73 (61%) Frame = +3 Query: 255 DKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434 +++ F+ E YD +A ++ L ++P D SV++ D K + LKR + L+L+ L IGN Sbjct: 5 ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64 Query: 435 IVNIFSKLLYIKD 473 VN+FS+ L + D Sbjct: 65 KVNVFSRQLVLID 77 >AL356852-1|CAI19238.1| 376|Homo sapiens non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) protein. Length = 376 Score = 56.4 bits (130), Expect = 7e-08 Identities = 27/73 (36%), Positives = 45/73 (61%) Frame = +3 Query: 255 DKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434 +++ F+ E YD +A ++ L ++P D SV++ D K + LKR + L+L+ L IGN Sbjct: 5 ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64 Query: 435 IVNIFSKLLYIKD 473 VN+FS+ L + D Sbjct: 65 KVNVFSRQLVLID 77 >AL031726-1|CAI18887.1| 376|Homo sapiens non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) protein. Length = 376 Score = 56.4 bits (130), Expect = 7e-08 Identities = 27/73 (36%), Positives = 45/73 (61%) Frame = +3 Query: 255 DKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434 +++ F+ E YD +A ++ L ++P D SV++ D K + LKR + L+L+ L IGN Sbjct: 5 ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64 Query: 435 IVNIFSKLLYIKD 473 VN+FS+ L + D Sbjct: 65 KVNVFSRQLVLID 77 >AF153191-1|AAD34622.1| 376|Homo sapiens nm23-H7 protein. Length = 376 Score = 56.4 bits (130), Expect = 7e-08 Identities = 27/73 (36%), Positives = 45/73 (61%) Frame = +3 Query: 255 DKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434 +++ F+ E YD +A ++ L ++P D SV++ D K + LKR + L+L+ L IGN Sbjct: 5 ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 64 Query: 435 IVNIFSKLLYIKD 473 VN+FS+ L + D Sbjct: 65 KVNVFSRQLVLID 77 >AB209049-1|BAD92286.1| 283|Homo sapiens nucleoside-diphosphate kinase 7 isoform a variant protein. Length = 283 Score = 56.4 bits (130), Expect = 7e-08 Identities = 27/73 (36%), Positives = 45/73 (61%) Frame = +3 Query: 255 DKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434 +++ F+ E YD +A ++ L ++P D SV++ D K + LKR + L+L+ L IGN Sbjct: 9 ERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGN 68 Query: 435 IVNIFSKLLYIKD 473 VN+FS+ L + D Sbjct: 69 KVNVFSRQLVLID 81 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,479,082 Number of Sequences: 237096 Number of extensions: 1190408 Number of successful extensions: 2443 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2443 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -