BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1132 (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) 54 6e-08 SB_29801| Best HMM Match : Collagen (HMM E-Value=3.2e-12) 27 7.6 >SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) Length = 229 Score = 54.4 bits (125), Expect = 6e-08 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = +1 Query: 391 IDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQI 498 +++DTRAYFT+AT+IIAVPTGIK+F LAT++G I Sbjct: 1 MNVDTRAYFTAATMIIAVPTGIKVFSWLATLYGGAI 36 >SB_29801| Best HMM Match : Collagen (HMM E-Value=3.2e-12) Length = 182 Score = 27.5 bits (58), Expect = 7.6 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = -3 Query: 186 GSPPPAGSKNDVFKFRSVNNIVIAPAKTGSDNNNKNAVIPTAHTNKGN*SNDILFNRI 13 G P G K D K R ++IAP K D+ +A + + GN S + +++I Sbjct: 77 GDAGPRGLKGDPGKIRDAPRVIIAPQKLNIDS---SATVVLNCSVSGNPSAPVTWSKI 131 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,978,732 Number of Sequences: 59808 Number of extensions: 178797 Number of successful extensions: 357 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -