BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1132 (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22165.1 68417.m03204 F-box family protein contains F-box dom... 28 3.6 At2g22840.1 68415.m02712 expressed protein identical to transcri... 27 6.2 >At4g22165.1 68417.m03204 F-box family protein contains F-box domain Pfam:PF00646 Length = 363 Score = 28.3 bits (60), Expect = 3.6 Identities = 10/39 (25%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 252 DWYNFSY-YFTRKRKKRNFWLFRNNLCYTSNWVIRIYCL 365 DW++FS+ +++ FW+ + Y W + +YC+ Sbjct: 144 DWFHFSHGHYSFSLSSPVFWIDEESKDYIVMWGLGVYCV 182 >At2g22840.1 68415.m02712 expressed protein identical to transcription activator GRL1 [Arabidopsis thaliana] GI:21539880 (unpublished); supporting cDNA gi|21539879|gb|AY102634.1| Length = 530 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 117 APAKTGSDNNNKNAVIPTAHTNKGN*SNDILFNRI 13 A A GSDNNN A + N S D L NR+ Sbjct: 272 AVAMRGSDNNNSLAAAVGTQHHTNNQSTDSLANRV 306 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,899,303 Number of Sequences: 28952 Number of extensions: 126320 Number of successful extensions: 255 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 255 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -