BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1128 (399 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 24 0.56 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 6.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 6.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 6.9 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 20 9.1 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 24.2 bits (50), Expect = 0.56 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 Query: 309 SILVRGASLGNGDSVTXNAIAVLIWVWRXTDHLT 208 SI R +++ +GD +T N + + + VWR +T Sbjct: 169 SIEARDSAIFDGDFITENNLPLGLEVWRDKVFIT 202 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 6.9 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 372 PPEHLKXAVPRSGAKLNARSTSILVRGASLGNGD 271 P HLK A + N+ +T ++R + GD Sbjct: 362 PENHLKNAKYLDVIERNSGATDKIIRWCTWSEGD 395 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 6.9 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 372 PPEHLKXAVPRSGAKLNARSTSILVRGASLGNGD 271 P HLK A + N+ +T ++R + GD Sbjct: 362 PENHLKNAKYLDVIERNSGATDKIIRWCTWSEGD 395 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 6.9 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 372 PPEHLKXAVPRSGAKLNARSTSILVRGASLGNGD 271 P HLK A + N+ +T ++R + GD Sbjct: 362 PENHLKNAKYLDVIERNSGATDKIIRWCTWSEGD 395 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 20.2 bits (40), Expect = 9.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 360 LKXAVPRSGAKLNARSTSILVRGASL 283 L+ A P AKL A + + GASL Sbjct: 33 LEFAFPNGYAKLAAIKSGSYIPGASL 58 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,698 Number of Sequences: 438 Number of extensions: 1228 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -