BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1123 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0211 + 7898434-7898574,7898759-7899349,7899575-7899821,790... 29 4.7 05_01_0475 - 3818121-3820565 28 6.2 >02_02_0211 + 7898434-7898574,7898759-7899349,7899575-7899821, 7900020-7900118,7900158-7900321,7900371-7900870, 7901007-7901256,7901461-7901549,7901823-7902064, 7902175-7902479,7902798-7902906,7903150-7903313 Length = 966 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 603 FQECNHSPLLSRTXVSKSKKTPTLYIGNL 689 F EC H+P++SRT + + PT + L Sbjct: 412 FVECRHTPVVSRTYSTNKRPLPTTEVVKL 440 >05_01_0475 - 3818121-3820565 Length = 814 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 122 LKMDMNNPPNQSYWFVLREDQSNVILS-TNNFVNQNPQ 232 + + +NPPN YW E S+ ++S N +N NP+ Sbjct: 209 IDLSRSNPPNM-YWSWSSEKSSSALISLLNQLININPE 245 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,279,845 Number of Sequences: 37544 Number of extensions: 290246 Number of successful extensions: 524 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -