BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1120 (499 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC132918-1|AAI32919.1| 317|Homo sapiens similar to 4931415M17 p... 55 2e-07 BC132916-1|AAI32917.1| 317|Homo sapiens similar to 4931415M17 p... 55 2e-07 AK097419-1|BAC05044.1| 271|Homo sapiens protein ( Homo sapiens ... 55 2e-07 BC129999-1|AAI30000.1| 216|Homo sapiens LOC730112 protein protein. 48 1e-05 >BC132918-1|AAI32919.1| 317|Homo sapiens similar to 4931415M17 protein protein. Length = 317 Score = 54.8 bits (126), Expect = 2e-07 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +3 Query: 117 SPNRNYIPGYTGHCPEYKYRIGDTYGSXTHKXLLDPSVQHSERLVL-PIXRP 269 +P +Y+PGY G P+ +Y++G+TYG T + L DPSVQ S VL P+ +P Sbjct: 11 TPEPHYVPGYAGFFPQLRYQVGNTYGRTTGQLLTDPSVQKSPCSVLSPMSKP 62 >BC132916-1|AAI32917.1| 317|Homo sapiens similar to 4931415M17 protein protein. Length = 317 Score = 54.8 bits (126), Expect = 2e-07 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +3 Query: 117 SPNRNYIPGYTGHCPEYKYRIGDTYGSXTHKXLLDPSVQHSERLVL-PIXRP 269 +P +Y+PGY G P+ +Y++G+TYG T + L DPSVQ S VL P+ +P Sbjct: 11 TPEPHYVPGYAGFFPQLRYQVGNTYGRTTGQLLTDPSVQKSPCSVLSPMSKP 62 >AK097419-1|BAC05044.1| 271|Homo sapiens protein ( Homo sapiens cDNA FLJ40100 fis, clone TESTI2004675. ). Length = 271 Score = 54.8 bits (126), Expect = 2e-07 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = +3 Query: 117 SPNRNYIPGYTGHCPEYKYRIGDTYGSXTHKXLLDPSVQHSERLVL-PIXRP 269 +P +Y+PGY G P+ +Y++G+TYG T + L DPSVQ S VL P+ +P Sbjct: 11 TPEPHYVPGYAGFFPQLRYQVGNTYGRTTGQLLTDPSVQKSPCSVLSPMSKP 62 >BC129999-1|AAI30000.1| 216|Homo sapiens LOC730112 protein protein. Length = 216 Score = 48.4 bits (110), Expect = 1e-05 Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Frame = +3 Query: 123 NRNYIPGYTGHCPEYKYRIGDTYGSXTHKXLLDP---SVQHSERLVLPIXRP 269 N +YIPGYTGHCP ++ +G TYG T + L P + R +LP RP Sbjct: 15 NPHYIPGYTGHCPLLRFSVGQTYGQVTGQLLRGPPGLAWPPVHRTLLPPIRP 66 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,473,647 Number of Sequences: 237096 Number of extensions: 1230330 Number of successful extensions: 2482 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2482 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -