BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1119 (648 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q554N7 Cluster: EGF-like domain-containing protein; n=2... 34 3.4 UniRef50_UPI000065E29B Cluster: Protein Dok-7 (Downstream of tyr... 33 4.5 UniRef50_Q89K70 Cluster: Bll5041 protein; n=2; Bradyrhizobiaceae... 33 7.9 UniRef50_A1VLJ8 Cluster: Putative uncharacterized protein; n=1; ... 33 7.9 >UniRef50_Q554N7 Cluster: EGF-like domain-containing protein; n=2; Dictyostelium discoideum|Rep: EGF-like domain-containing protein - Dictyostelium discoideum AX4 Length = 1918 Score = 33.9 bits (74), Expect = 3.4 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +2 Query: 110 GDSFQFCK-MTSCCTCEGHHSGAKSSLPLV 196 G SF C T CTC+G GA SLPL+ Sbjct: 1256 GSSFGSCNNQTGVCTCDGSQQGADCSLPLI 1285 >UniRef50_UPI000065E29B Cluster: Protein Dok-7 (Downstream of tyrosine kinase 7).; n=1; Takifugu rubripes|Rep: Protein Dok-7 (Downstream of tyrosine kinase 7). - Takifugu rubripes Length = 233 Score = 33.5 bits (73), Expect = 4.5 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = +2 Query: 164 HSGAKSSLPLVCLVP-----RDGASSEARTKPRPA*LGPQLKMISSCSTRSTSGKTLSC 325 H+ K++L +CL+ D AS+E R + L +L M+S CS S++ T SC Sbjct: 55 HANVKTTLSPLCLLGPADLGADPASAEERICQEASDLEKRLSMLSECSLASSTASTYSC 113 >UniRef50_Q89K70 Cluster: Bll5041 protein; n=2; Bradyrhizobiaceae|Rep: Bll5041 protein - Bradyrhizobium japonicum Length = 603 Score = 32.7 bits (71), Expect = 7.9 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = +1 Query: 199 PGSSRWSIFGSQDKAPACIAGPTTQNDFQLLDE 297 PG + WS+FG+ AP +A PT Q++ QLLD+ Sbjct: 85 PGGAMWSLFGAM-VAPG-VAVPTAQHEQQLLDK 115 >UniRef50_A1VLJ8 Cluster: Putative uncharacterized protein; n=1; Polaromonas naphthalenivorans CJ2|Rep: Putative uncharacterized protein - Polaromonas naphthalenivorans (strain CJ2) Length = 1991 Score = 32.7 bits (71), Expect = 7.9 Identities = 23/68 (33%), Positives = 34/68 (50%) Frame = -1 Query: 372 GYKGTSIRVQIQRPLWQLKVFPDVLLVEQLEIILSCGPSYAGRGFVLASEDAPSRGTRQT 193 GY V + R L + + VE LE+++SC P++A RG L + + TR+ Sbjct: 38 GYAAIQNAVPVVRALRLTNLMAET--VENLEVVVSCSPAFA-RGLKLRFDKLAAGETRRI 94 Query: 192 SGRLDLAP 169 S LDL P Sbjct: 95 S-PLDLQP 101 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 616,895,909 Number of Sequences: 1657284 Number of extensions: 12164955 Number of successful extensions: 29422 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 28556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29412 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -