BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1113 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 26 0.30 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 25 0.52 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 6.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.4 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 8.5 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 8.5 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 26.2 bits (55), Expect = 0.30 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 194 FWRRTXAAXARVQLKLDTVELLATSAAQSQ 105 FW + AA ARV L + ++ L+T A+SQ Sbjct: 266 FWIKPEAAPARVTLGVTSLLTLSTQHAKSQ 295 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 25.4 bits (53), Expect = 0.52 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 194 FWRRTXAAXARVQLKLDTVELLATSAAQSQ 105 FW + A ARV L + ++ LAT QSQ Sbjct: 235 FWIKPEAIPARVTLGVTSLLTLATQNTQSQ 264 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 525 VNSISSYXHQCTSARSF 475 VN ++SY C S R+F Sbjct: 291 VNIVTSYCKTCISGRAF 307 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 240 TVKYLPCRGSHATIMFLASNIXSVSSGT 157 T KY+ +A + LAS I S S+GT Sbjct: 2 TAKYVFTTLINAAFLCLASTILSESAGT 29 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 194 FWRRTXAAXARVQLKLDTVELLATSAA 114 FW A ARV L + T+ +AT + Sbjct: 263 FWLDQSAVPARVSLGVTTLLTMATQTS 289 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 194 FWRRTXAAXARVQLKLDTVELLATSAA 114 FW A ARV L + T+ +AT + Sbjct: 263 FWLDQSAVPARVSLGVTTLLTMATQTS 289 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,917 Number of Sequences: 438 Number of extensions: 3621 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -