BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1111 (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44686| Best HMM Match : DUF1126 (HMM E-Value=0.37) 50 2e-06 SB_6227| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_51241| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) 28 7.5 SB_25559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_24829| Best HMM Match : Gelsolin (HMM E-Value=5.8e-35) 28 7.5 SB_44805| Best HMM Match : Col_cuticle_N (HMM E-Value=2.7) 27 9.9 >SB_44686| Best HMM Match : DUF1126 (HMM E-Value=0.37) Length = 93 Score = 49.6 bits (113), Expect = 2e-06 Identities = 27/73 (36%), Positives = 39/73 (53%) Frame = +3 Query: 255 DKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDMLQIGN 434 ++++FL E YD A + L ++ DNSV++ D K + LKR + D IG Sbjct: 5 ERFAFLAEWYDPQAALTRKYQLLFYASDNSVEMYDIKNRRLFLKRSKCDQYKADDFYIGA 64 Query: 435 IVNIFSKLLYIQD 473 IVNI S+ L I D Sbjct: 65 IVNIHSRQLKITD 77 >SB_6227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/69 (27%), Positives = 28/69 (40%), Gaps = 2/69 (2%) Frame = -3 Query: 601 HRTSEXHFXDEVIIYXVHWE--LSA*SCKCTWHFWKSVFRVAGAQSWIYNNFENILTILP 428 H + HF + + V+WE L + +WH WK+ F A + N E T P Sbjct: 19 HDFNPDHFIAD--LNDVNWEGFLDSNEANSSWHLWKNAFMEAHPPFASWRNSEEARTDRP 76 Query: 427 ICNISKFNG 401 + NG Sbjct: 77 SQQLRSLNG 85 >SB_51241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = -2 Query: 386 FQNIFAFLRVYYLNRIVKWKIIEG*IFYFVSILIIHFTQETIFIK*SYTIAI 231 + N L V+Y NR++ ++ YFV +L +H+T I + YT + Sbjct: 57 YTNRVIVLPVHYTNRVI---VLPVNYTYFVIVLPVHYTNRVIVLPVHYTYLV 105 >SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) Length = 488 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +3 Query: 300 EIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPLNLDML 422 ++ ++T+N PF ++ ++ L V+LPP LD + Sbjct: 298 DLNEITMNLVPFPKLHYLVSSQTPLYALTDVKLPPRRLDQM 338 >SB_25559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 435 IVNIFSKLLYIQDCAPATRKTLFQKCQVHLHD 530 + ++ + ++QDCAPA + QKC + D Sbjct: 49 LFSVNQNVTFVQDCAPAHTAKVPQKCHLKYRD 80 >SB_24829| Best HMM Match : Gelsolin (HMM E-Value=5.8e-35) Length = 1078 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/75 (20%), Positives = 37/75 (49%) Frame = +3 Query: 228 IDSNGIRLLDKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQIIDAKKGKNVLKRVQLPPL 407 ++S+ + +LDK + + D D+ + + L +++ + KKGK + R Sbjct: 954 LNSDDVFILDKGKTIYQK--GDYDDFEPVLLRVSDASGQMKLTEMKKGKGRITRNDFDEK 1011 Query: 408 NLDMLQIGNIVNIFS 452 ++ + GN++ ++S Sbjct: 1012 DVFLFDTGNVLFVYS 1026 >SB_44805| Best HMM Match : Col_cuticle_N (HMM E-Value=2.7) Length = 251 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +3 Query: 255 DKYSFLCEMYDEDADEIKDLTLNYFPFDNSVQIIDA---KKGKNVLKR 389 D Y FL + + +E D+ YF + V+II + +KG N R Sbjct: 185 DVYEFLRAEDEAEVEEFNDILYEYFGMNARVEIITSSRRRKGNNAKSR 232 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,578,557 Number of Sequences: 59808 Number of extensions: 314709 Number of successful extensions: 713 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -