BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1107 (419 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1498 + 26995209-26995752,26995945-26996513 28 3.5 10_05_0027 + 8286522-8286542,8286739-8287296,8287378-8287501,828... 27 4.6 >07_03_1498 + 26995209-26995752,26995945-26996513 Length = 370 Score = 27.9 bits (59), Expect = 3.5 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = +3 Query: 180 CPKKNC*TRGRLCDER----WHTP*APNSFRYPTFKLTS 284 CP+ GR C R W TP PNSF Y + K+ S Sbjct: 258 CPQLANLGSGRFCIARFFHTWTTPMEPNSFGYDSIKVHS 296 >10_05_0027 + 8286522-8286542,8286739-8287296,8287378-8287501, 8289499-8289629 Length = 277 Score = 27.5 bits (58), Expect = 4.6 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 311 VSPHRYHCSACQFKGGIAETIWSLRSVPPFITE 213 +S HR S +GG AET+ ++ VPP TE Sbjct: 2 LSLHRSLISPSLERGGRAETLTAIAGVPPLRTE 34 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,039,509 Number of Sequences: 37544 Number of extensions: 246471 Number of successful extensions: 460 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 766563072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -