BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1107 (419 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L08187-1|AAA93193.1| 229|Homo sapiens cytokine receptor protein. 30 3.6 EF064740-1|ABK41923.1| 229|Homo sapiens Epstein-Barr virus indu... 30 3.6 BC046112-1|AAH46112.1| 229|Homo sapiens Epstein-Barr virus indu... 30 3.6 BC015364-1|AAH15364.1| 229|Homo sapiens Epstein-Barr virus indu... 30 3.6 AC005578-2|AAC33488.1| 229|Homo sapiens Human cytokine receptor... 30 3.6 >L08187-1|AAA93193.1| 229|Homo sapiens cytokine receptor protein. Length = 229 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 219 DERWHTP*APNSFRYPTFKLTSRTMIPVRAHTKPCLR 329 D W P APNS +F T R + R H+ PCL+ Sbjct: 45 DCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQ 81 >EF064740-1|ABK41923.1| 229|Homo sapiens Epstein-Barr virus induced gene 3 protein. Length = 229 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 219 DERWHTP*APNSFRYPTFKLTSRTMIPVRAHTKPCLR 329 D W P APNS +F T R + R H+ PCL+ Sbjct: 45 DCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQ 81 >BC046112-1|AAH46112.1| 229|Homo sapiens Epstein-Barr virus induced gene 3 protein. Length = 229 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 219 DERWHTP*APNSFRYPTFKLTSRTMIPVRAHTKPCLR 329 D W P APNS +F T R + R H+ PCL+ Sbjct: 45 DCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQ 81 >BC015364-1|AAH15364.1| 229|Homo sapiens Epstein-Barr virus induced gene 3 protein. Length = 229 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 219 DERWHTP*APNSFRYPTFKLTSRTMIPVRAHTKPCLR 329 D W P APNS +F T R + R H+ PCL+ Sbjct: 45 DCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQ 81 >AC005578-2|AAC33488.1| 229|Homo sapiens Human cytokine receptor protein. Length = 229 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 219 DERWHTP*APNSFRYPTFKLTSRTMIPVRAHTKPCLR 329 D W P APNS +F T R + R H+ PCL+ Sbjct: 45 DCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQ 81 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,231,938 Number of Sequences: 237096 Number of extensions: 1349596 Number of successful extensions: 2387 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2387 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3202085264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -