BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1103 (309 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 1.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 1.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 2.6 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 1.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 42 FFLHDQILESVYL 80 FFLH Q+L YL Sbjct: 259 FFLHKQVLNRYYL 271 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 1.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 42 FFLHDQILESVYL 80 FFLH Q+L YL Sbjct: 259 FFLHKQVLNRYYL 271 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 2.6 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +2 Query: 83 IRFGGFQIFSAIMREIVHIQAGQCGNQIGAKFWE---VISDEHGIDATGAYS 229 I FG Q + +MR + A + IG+ W ++SD + + G S Sbjct: 346 IIFGSDQEVAGVMRAVKRCNATGAFSWIGSDGWSARGLVSDGNEAEVEGTLS 397 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,098 Number of Sequences: 438 Number of extensions: 1977 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6471036 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -