BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1101 (329 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.31 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.31 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 2.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 2.2 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 2.9 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.31 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -3 Query: 252 AFKLQVGVAAVSTRGVNAVLVRDYFPELCSDLIPALTRLDVDDF 121 A+K+ V V ++RG AVL R P DL+ ++ L F Sbjct: 131 AYKVDVEVIGGASRGCTAVL-RCVVPSFVKDLVRVVSWLQEPSF 173 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.31 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -3 Query: 252 AFKLQVGVAAVSTRGVNAVLVRDYFPELCSDLIPALTRLDVDDF 121 A+K+ V V ++RG AVL R P DL+ ++ L F Sbjct: 131 AYKVDVEVIGGASRGCTAVL-RCVVPSFVKDLVRVVSWLQEPSF 173 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 2.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 38 FFLHDQILESVYL 76 FFLH Q+L YL Sbjct: 259 FFLHKQVLNRYYL 271 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 2.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 38 FFLHDQILESVYL 76 FFLH Q+L YL Sbjct: 259 FFLHKQVLNRYYL 271 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 2.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 249 THNVYYNEAS 278 THN+YYN S Sbjct: 261 THNLYYNSPS 270 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,302 Number of Sequences: 438 Number of extensions: 2164 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7342137 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -