BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1099 (285 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ007714-1|CAA07619.2| 926|Homo sapiens lysine-ketoglutarate re... 28 6.3 AF229180-1|AAF44328.1| 926|Homo sapiens alpha-aminoadipate semi... 28 6.3 AC006020-2|AAF03526.1| 926|Homo sapiens lysine ketoglutarate re... 28 6.3 AB037732-1|BAA92549.1| 889|Homo sapiens KIAA1311 protein protein. 28 6.3 >AJ007714-1|CAA07619.2| 926|Homo sapiens lysine-ketoglutarate reductase /saccharopine dehydrogenase protein. Length = 926 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 7/37 (18%) Frame = -3 Query: 259 HHIALNTDGCHR-----RHPRRYVSEFN--ISSCSTC 170 HH+ TD + +HP RY+S FN I+ +TC Sbjct: 269 HHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTC 305 >AF229180-1|AAF44328.1| 926|Homo sapiens alpha-aminoadipate semialdehyde synthase protein. Length = 926 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 7/37 (18%) Frame = -3 Query: 259 HHIALNTDGCHR-----RHPRRYVSEFN--ISSCSTC 170 HH+ TD + +HP RY+S FN I+ +TC Sbjct: 269 HHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTC 305 >AC006020-2|AAF03526.1| 926|Homo sapiens lysine ketoglutarate reductase/saccharopine dehydrogenase protein. Length = 926 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 7/37 (18%) Frame = -3 Query: 259 HHIALNTDGCHR-----RHPRRYVSEFN--ISSCSTC 170 HH+ TD + +HP RY+S FN I+ +TC Sbjct: 269 HHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTC 305 >AB037732-1|BAA92549.1| 889|Homo sapiens KIAA1311 protein protein. Length = 889 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 157 TESRGRSMGRSKNRRVLHTYSYRDRSK 77 + SR RS GRSK+R +R+RSK Sbjct: 6 SRSRSRSRGRSKDRDPNRNVEHRERSK 32 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,665,290 Number of Sequences: 237096 Number of extensions: 360392 Number of successful extensions: 505 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 76,859,062 effective HSP length: 71 effective length of database: 60,025,246 effective search space used: 1380580658 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -