BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1095 (528 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 1.7 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 6.7 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 6.7 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 6.7 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 8.9 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 8.9 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 8.9 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 23.0 bits (47), Expect = 1.7 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +3 Query: 162 KLVKNFQRLTHFL*YWRYKCSRHFFCHRIFSYITEWLQY 278 KL K +L H L + YK ++ F +F I W+ + Sbjct: 110 KLHKLDNKLKHMLIWKSYKRTQIFITCELFFVILLWISF 148 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.0 bits (42), Expect = 6.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 113 AFVGCINFSQ*KL*VSKTCKKLSKV 187 AF GC+ Q K CK SKV Sbjct: 11 AFFGCVRAQQLKGNQEDPCKLKSKV 35 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 6.7 Identities = 13/58 (22%), Positives = 27/58 (46%) Frame = +1 Query: 256 TLQSGFSIEGSYTISAPSITSGLLFGRSVISFQSNILTSVSESPVKIGPAVPEISNST 429 T + +++ T+ +P+I L +Q + + S+SP +I V ++N T Sbjct: 303 TYSTWSTVQTPTTVMSPTINCWSLTSSPPPPYQISAQPTPSQSPNQIYQPVTNLTNLT 360 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.0 bits (42), Expect = 6.7 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = -1 Query: 171 LQVLETYNFHCEKLMQPTNAHIEXDHTHINRC 76 L ++ +Y+ C K Q N + D N C Sbjct: 200 LDLIGSYSCKCPKGFQGQNCELNVDDCKPNPC 231 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -1 Query: 225 VNIYIASIIRNELTFESFLQVLETYNFHC 139 V+IY S RNE+ + L + + +C Sbjct: 49 VSIYSKSFHRNEIHIKIVLMFFKEASLYC 77 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 20.6 bits (41), Expect = 8.9 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 117 LLVALIFHNENYRFPKLVKNF 179 ++ +L+F N R+PK VK++ Sbjct: 96 VMASLLFLNLAKRWPKFVKDW 116 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 20.6 bits (41), Expect = 8.9 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 117 LLVALIFHNENYRFPKLVKNF 179 ++ +L+F N R+PK VK++ Sbjct: 96 VMASLLFLNLAKRWPKFVKDW 116 Score = 20.6 bits (41), Expect = 8.9 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 176 VFYKFWKPIIFIVKN 132 V Y WK +IF + N Sbjct: 514 VDYSLWKALIFQISN 528 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,729 Number of Sequences: 336 Number of extensions: 2540 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -