BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1095 (528 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) 28 4.1 >SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2409 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 250 FHTLQSGFSIEGSYTISAPSITSGLLFGRSVISFQSNILTSVSESPVKIGPAV 408 F+ GF EG Y + AP +T G + GR+ ++ +L ++ P+ +GP + Sbjct: 333 FYAAFFGF-FEGCYVLLAPVLT-GDIVGRNNMATGVGVLFAIKSVPLTLGPPI 383 >SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) Length = 460 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 319 GLLFGRSVISFQSNILTSVSESPVKIGPAVPEISNSTNIAN 441 GLL GR + N L + S + P PE+SNS N+ N Sbjct: 131 GLLGGRKAETEPRN-LGAKSRLTANVNPFTPELSNSLNVNN 170 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,646,755 Number of Sequences: 59808 Number of extensions: 254734 Number of successful extensions: 587 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1197191618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -