BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1091 (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 0.88 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 2.7 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 22 3.6 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 4.7 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 0.88 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 283 QENISLQYFYHDL-FEI*FVYGIKLIIICTV 372 ++N+ + Y D + I F Y I LI++CTV Sbjct: 802 EDNLLVCNSYVDASYMIAFAYPIMLIVVCTV 832 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.2 bits (45), Expect = 2.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 169 HLHQVKLHKRDNKHTFQRVWRDAQ 98 ++ +VK K +KH Q W D + Sbjct: 325 YIPKVKNKKAGSKHLLQNTWLDPE 348 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.8 bits (44), Expect = 3.6 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +1 Query: 88 PKNTEHRARHAGKCACCPACVTLLGEGATCKIYSKELGETPSAV 219 P N A A KCA L E A C+ K + +P V Sbjct: 153 PMNRNRPAYLASKCALTTLTDCLRSELAQCESNIKVISISPDLV 196 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.4 bits (43), Expect = 4.7 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +1 Query: 106 RARHAGKCACCPACVTLLGEGAT 174 + RH CC C L G G++ Sbjct: 3 KGRHVVMSCCCWCCDNLGGPGSS 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,079 Number of Sequences: 438 Number of extensions: 2499 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -