BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1087 (349 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 0.39 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 2.7 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 3.6 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 3.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.8 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 24.2 bits (50), Expect = 0.39 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 98 PHGSTFRLGADSGRFSQCCSRPPCEQR 178 P+G T G D G + CS PCE + Sbjct: 88 PYGYT---GKDCGEYVDWCSTNPCENQ 111 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.4 bits (43), Expect = 2.7 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 82 LSVLVASWINISAWG*LRKIFSVL 153 LSV+ +S+++I+ W L K F + Sbjct: 488 LSVIKSSFLDINTWKMLVKSFDAI 511 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.0 bits (42), Expect = 3.6 Identities = 11/31 (35%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -2 Query: 312 AVLTEISSGAK-CWTSRFTWTYPYHF*CWSQ 223 A TE G W S ++ PY CW+Q Sbjct: 366 AATTEREGGYHDIWMSGESFKSPYKASCWAQ 396 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 3.6 Identities = 11/31 (35%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = -2 Query: 312 AVLTEISSGAK-CWTSRFTWTYPYHF*CWSQ 223 A TE G W S ++ PY CW+Q Sbjct: 366 AATTEREGGYHDIWMSGESFKSPYKASCWAQ 396 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 4.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 211 RLETLAPASKVIRISPSKPGRPAFRP 288 + E P K S KP +P++RP Sbjct: 1151 KCEEKKPGHKPSTSSWQKPTKPSYRP 1176 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,107 Number of Sequences: 336 Number of extensions: 1706 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6876025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -