Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS1083
         (538 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00006CB594 Cluster: hypothetical protein TTHERM_0053...    32   9.6  

>UniRef50_UPI00006CB594 Cluster: hypothetical protein TTHERM_00535380;
            n=1; Tetrahymena thermophila SB210|Rep: hypothetical
            protein TTHERM_00535380 - Tetrahymena thermophila SB210
          Length = 3005

 Score = 31.9 bits (69), Expect = 9.6
 Identities = 19/56 (33%), Positives = 30/56 (53%)
 Frame = +3

Query: 279  NWKTNYFIISKSQVLKLMTLTKKLCRILKSNVFCVLIK*NID*E*NC*IYCVVFLN 446
            +WK N FI  K  +++++ L+   C+I + N    LIK N        +Y VV+LN
Sbjct: 1524 HWKCNLFIFKKEVIIEIIELSTYKCQIYQFNKEVYLIKQNQ-------LYQVVYLN 1572


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 438,499,123
Number of Sequences: 1657284
Number of extensions: 7729962
Number of successful extensions: 14377
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14011
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14376
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 34156095254
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)