BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1083 (538 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069732-1|AAL39877.1| 437|Drosophila melanogaster LP04395p pro... 29 3.0 AE014134-3119|AAF53816.2| 1361|Drosophila melanogaster CG10132-P... 29 3.0 >AY069732-1|AAL39877.1| 437|Drosophila melanogaster LP04395p protein. Length = 437 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +2 Query: 245 RIMIADMISDSQLENELFHNFEVTSIKIDDINKKIMSNFKE*R 373 +I+I D+++ + + HN VT +K+D + K ++S KE R Sbjct: 312 KILIWDLVTGNCKSTLIGHNAPVTFLKLDPLGKVLLSYDKEGR 354 >AE014134-3119|AAF53816.2| 1361|Drosophila melanogaster CG10132-PA protein. Length = 1361 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +2 Query: 245 RIMIADMISDSQLENELFHNFEVTSIKIDDINKKIMSNFKE*R 373 +I+I D+++ + + HN VT +K+D + K ++S KE R Sbjct: 1236 KILIWDLVTGNCKSTLIGHNAPVTFLKLDPLGKVLLSYDKEGR 1278 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,398,079 Number of Sequences: 53049 Number of extensions: 342130 Number of successful extensions: 513 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2032955904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -