BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1083 (538 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24120.2 68415.m02882 DNA-directed RNA polymerase, chloroplas... 28 4.5 At2g24120.1 68415.m02881 DNA-directed RNA polymerase, chloroplas... 28 4.5 >At2g24120.2 68415.m02882 DNA-directed RNA polymerase, chloroplast (RPOPT) identical to SP|O24600 DNA-directed RNA polymerase, chloroplast precursor (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1035 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 170 VRKYAVICCRCGLNSNCSRYRKHLFIPHAP 81 VR+Y VI C L + + KH+ IP+ P Sbjct: 394 VRRYGVIECDSLLLAGLDKSAKHMLIPYVP 423 >At2g24120.1 68415.m02881 DNA-directed RNA polymerase, chloroplast (RPOPT) identical to SP|O24600 DNA-directed RNA polymerase, chloroplast precursor (EC 2.7.7.6) {Arabidopsis thaliana} Length = 993 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 170 VRKYAVICCRCGLNSNCSRYRKHLFIPHAP 81 VR+Y VI C L + + KH+ IP+ P Sbjct: 394 VRRYGVIECDSLLLAGLDKSAKHMLIPYVP 423 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,529,483 Number of Sequences: 28952 Number of extensions: 166918 Number of successful extensions: 256 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 256 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 993966856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -