BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1078 (379 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0234 - 26602660-26602728,26602814-26602988,26603077-266031... 33 0.056 06_01_0356 + 2557127-2557193,2557272-2557315,2557433-2557528,255... 31 0.23 06_03_0740 - 24006485-24006629,24006821-24006864,24006954-240071... 31 0.30 01_06_0465 - 29573972-29574110,29574300-29574343,29574434-295746... 29 1.2 06_03_0073 + 16229369-16230115,16230182-16230431,16230618-162307... 29 1.6 01_02_0017 - 10215995-10217018,10217120-10217249,10217364-10217496 27 4.9 >05_06_0234 - 26602660-26602728,26602814-26602988,26603077-26603120, 26603204-26603381,26603468-26603652,26603737-26603801, 26603985-26604066,26604342-26604434,26605096-26605191, 26605312-26605355,26605467-26605530 Length = 364 Score = 33.5 bits (73), Expect = 0.056 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +1 Query: 265 DIEAKFYSEVHALECKYEKLYK 330 D+EAKF+ E ALE KY+K+Y+ Sbjct: 73 DLEAKFFEERAALEAKYQKMYE 94 >06_01_0356 + 2557127-2557193,2557272-2557315,2557433-2557528, 2559259-2559351,2559450-2559540,2559617-2559678, 2559754-2559938,2560022-2560199,2560293-2560336, 2560440-2560635,2560728-2560745,2560955-2561005 Length = 374 Score = 31.5 bits (68), Expect = 0.23 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +1 Query: 265 DIEAKFYSEVHALECKYEKLYK 330 +IE KF+ E ALE KY+KLY+ Sbjct: 74 EIELKFFEERAALEAKYQKLYE 95 >06_03_0740 - 24006485-24006629,24006821-24006864,24006954-24007122, 24007226-24007413,24007572-24007634,24007992-24008084, 24009837-24009932,24010024-24010067,24010184-24010357, 24010764-24010974 Length = 408 Score = 31.1 bits (67), Expect = 0.30 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +1 Query: 265 DIEAKFYSEVHALECKYEKLY 327 ++E KF+ E ALE KY+KLY Sbjct: 180 ELEVKFFEEKAALEAKYQKLY 200 >01_06_0465 - 29573972-29574110,29574300-29574343,29574434-29574602, 29574707-29574894,29575081-29575145,29575257-29575311, 29575502-29575594,29576035-29576130,29576259-29576302, 29576419-29576431 Length = 301 Score = 29.1 bits (62), Expect = 1.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 265 DIEAKFYSEVHALECKYEKLY 327 ++EAKF E ALE Y+KLY Sbjct: 56 ELEAKFLEEKAALEANYQKLY 76 >06_03_0073 + 16229369-16230115,16230182-16230431,16230618-16230728, 16230768-16231153 Length = 497 Score = 28.7 bits (61), Expect = 1.6 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = +1 Query: 196 RWHPTPECSSANPRLENSSEEFVDIEAKFYSEVHALECKYEKLYKLFMKSEL 351 RW P P+ S P ++ FV++ K Y V L+ Y ++K L Sbjct: 402 RWLPFPQ-RSRKPSVDEQFARFVEVIQKIYINVPLLDAMQVPTYARYLKDIL 452 >01_02_0017 - 10215995-10217018,10217120-10217249,10217364-10217496 Length = 428 Score = 27.1 bits (57), Expect = 4.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 164 SGHHKSPSCRSDGILP 211 SGH PSCRS G +P Sbjct: 208 SGHENLPSCRSSGPIP 223 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,903,623 Number of Sequences: 37544 Number of extensions: 171924 Number of successful extensions: 365 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 612769692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -