BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS1078 (379 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 2.1 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 4.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 6.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 6.4 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 2.1 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -1 Query: 307 IRVHVLHCKTWPQCRQTPLKSSQGADSPTNIR 212 ++ HVL T P+ + TP ++ NIR Sbjct: 391 VQTHVLTIHTIPEVKVTPRFQAKRLKEEANIR 422 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 4.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 278 SFTVKYMHSNANMKNFTSSL 337 S + K +H+N N KN+ L Sbjct: 317 SLSNKTIHNNNNYKNYNKKL 336 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.6 bits (41), Expect = 6.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 217 CSSANPRLENSSEEFVDIEAKFYSEV 294 CS++NP E S+E + + A + EV Sbjct: 310 CSASNPGGEASAEIRLIVTAPLHVEV 335 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.6 bits (41), Expect = 6.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 217 CSSANPRLENSSEEFVDIEAKFYSEV 294 CS++NP E S+E + + A + EV Sbjct: 310 CSASNPGGEASAEIRLIVTAPLHVEV 335 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,693 Number of Sequences: 438 Number of extensions: 1533 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9176370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -